KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729108
Entry
103729108         CDS       T03372                                 

Gene name
Mcl1
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04630  JAK-STAT signaling pathway
ngi05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103729108 (Mcl1)
   04151 PI3K-Akt signaling pathway
    103729108 (Mcl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103729108 (Mcl1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103729108 (Mcl1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 103729108
NCBI-ProteinID: XP_008825306
LinkDB
Position
Un
AA seq 340 aa
MFGLRRNAVIGLNLYCGGASLAAGGSSPAGARLVAEEAKARCEGGGEAGAGSGGSVSGPA
ALLPDARRVARPPPIGAEVPDVTATPEKLMLFPAGRASPPEDMAAPAAAIMSPEEELDGY
EPEPLGKRPAVLPLRGLVGEAAKSSGTDGSLPSTPPPVEEDDELYRQSLAIISRYLREQA
TGAKDAKPLGGAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVRTKRDWLVKQK
GWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtttggcctgagaaggaacgcggtaatcggcctcaacctgtactgcgggggcgccagc
ctcgcggcaggcggcagttctccggcgggagcgcgcctggtggccgaggaggccaaggca
cggtgcgaggggggaggggaggccggcgcgggctcgggcggaagtgtgagcggccctgca
gccctgctgccagacgcgcggagggtcgcgcggccgccgcccattggcgccgaagtcccc
gacgtcaccgcgacccccgagaagctgatgctcttcccagcgggtcgtgcgtcgccgcct
gaggacatggccgcgccggccgccgccatcatgtctcctgaggaggagttggacggctac
gaacccgagccgctcgggaagcggccggccgtgctacccctgcgggggctggtcggcgag
gcggcgaagagctcgggcactgacggctcgctgccctccacgccgccgccggtcgaggag
gacgacgagctgtaccgccagtcgctggcgatcatctcccggtacctgcgcgagcaggcc
acaggcgccaaggacgcgaagcctctgggcggggcgggggcggcgggccggagggcgttg
gagacccttcggcgagtgggcgacggtgtgcagcgcaaccacgaaacggccttccaaggc
atgcttcggaaactggacattaaaaatgaagatgatgtcaaatctttgtctcgagtgatg
gtccatgttttcagtgacggcgtaacaaactggggcaggattgtgactctgatttctttt
ggtgcctttgtggccaaacacttgaagagcataaaccaagaaagttgcatcgacccatta
gcagaaagtatcacagatgttcttgtaaggacaaaacgagactggctagtcaaacaaaaa
ggctgggatgggtttgtggagttcttccacgtacaggacctagaaggcggcatcagaaat
gtgctgctggcttttgcaggtgttgctggagtaggggctggtttggcatatctaataaga
tag

DBGET integrated database retrieval system