KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729150
Entry
103729150         CDS       T03372                                 

Gene name
Mitf
Definition
(RefSeq) melanogenesis associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04137  Mitophagy - animal
ngi04380  Osteoclast differentiation
ngi04916  Melanogenesis
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05218  Melanoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103729150 (Mitf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103729150 (Mitf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103729150 (Mitf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103729150 (Mitf)
   05202 Transcriptional misregulation in cancer
    103729150 (Mitf)
  09162 Cancer: specific types
   05218 Melanoma
    103729150 (Mitf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103729150 (Mitf)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    103729150 (Mitf)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH
Other DBs
NCBI-GeneID: 103729150
NCBI-ProteinID: XP_017652118
LinkDB
Position
Un
AA seq 526 aa
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFIQQRVPVGQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS
PMAMLTLNSNCEKEGFYKFEEQNRAENECPSMNTHTRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQELLQHQADLTCTTTLDLTDGTITFTNNLGTVPESSPAYSVPTKMGSK
LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSTEEAEHAC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcagtccgaatccgggatcgtgccggatttcgaagtcggggaggagtttcacgaagaa
cccaaaacctattacgaactcaaaagtcaacctctgaagagcagcagttctgcggagcat
cctggggcctccaagcctccgataagctcctccagtatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcggctcagttcatacaacagagagtgcccgtgggtcagacaccagctataaacgtc
agcgtgcccaccacccttccctctgccacccaggtgccgatggaagtccttaaggtgcag
acccacctcgaaaaccccaccaagtaccacatacagcaagcccaaaggcagcaggtaaag
cagtacctttctaccactttagcaaataaacatgccaaccaagtcctgagcttgccatgt
ccaaaccagcctggcgatcatgtcatgccaccggtgccggggagcagcgcacccaacagc
cccatggctatgctcactcttaactccaactgtgaaaaagagggattttataagtttgaa
gagcaaaacagggcggagaacgagtgcccaagtatgaacacgcacactcgcgcatcgtgc
atgcagatggatgatgtaattgatgacatcattagcctggaatcaagttataatgaagaa
atcttgggcttgatggatccagccttgcaaatggcaaatacgttacctgtctctggaaac
ttgattgacctatatagcaaccagggtctaccacctccaggtctcaccatcagcaactca
tgtccagccaatcttcccaacataaaaagggagctcacagcgtgtattttccccacagag
tctgaagcaagagcactggctaaagagaggcagaaaaaggacaatcacaacttaattgaa
cgaagaagaagatttaacataaatgaccgtattaaagagctaggtactttgattcccaag
tcaaatgatccggacatgcgctggaacaagggaaccattttaaaggcatccgtggactac
atcagaaagctgcaacgagagcagcaacgtgcaaaggaacttgaaaaccgacagaagaag
ctggagcatgccaatcggcacctcttgctcagaatacaggaactcgaaatgcaggctcga
gcacacggcctttccctcatcccatccactggcctctgctcaccggatttggtgaaccgg
atcatcaaacaagaaccagttcttgagaactgcagccaagaacttctgcagcaccaggcg
gatctgacttgtacgacaacccttgatctcacggacggcaccataaccttcaccaacaac
ctcgggactgtacctgagagcagcccagcctatagcgtccccacaaagatgggctccaag
ctggaagacatcttgatggacgataccctctcccctgttggtgtcaccgacccactcctg
tcgtcagtgtcccctggagcgtccaaaacaagcagccggagaagcagtatgagcacagaa
gaggcggagcatgcgtgttag

DBGET integrated database retrieval system