KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729189
Entry
103729189         CDS       T03372                                 

Gene name
Jag1
Definition
(RefSeq) jagged 1
  KO
K06052  jagged-1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04371  Apelin signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04668  TNF signaling pathway
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103729189 (Jag1)
   04371 Apelin signaling pathway
    103729189 (Jag1)
   04668 TNF signaling pathway
    103729189 (Jag1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103729189 (Jag1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103729189 (Jag1)
  09162 Cancer: specific types
   05224 Breast cancer
    103729189 (Jag1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103729189 (Jag1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103729189 (Jag1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103729189 (Jag1)
CD molecules [BR:ngi04090]
 Proteins
  103729189 (Jag1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3
Other DBs
NCBI-GeneID: 103729189
NCBI-ProteinID: XP_008825406
LinkDB
Position
Un
AA seq 1218 aa
MRSPRTRGRLGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGSRN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCRETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCEDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCRQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCVCPPGQSGAKCQEVSGRSCITMGRVIPDGAKWDDDCNTCQCLNGRVACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCASDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSLSANNEIHVAISAED
TRDDGNPIKEITDKIIDLVSKREGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPNSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKAPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggcaggctcgggcgccccctgagcctcctgctcgccctg
ctctgtgccctgcgagccaaggtgtgcggggcctcgggtcagttcgagctggagatcctg
tccatgcagaacgtgaacggagagctgcagaacgggaactgctgcggcggctcccggaac
cctggggaccgcaagtgcacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggctccgggtccacgcct
gtcatcgggggcaacaccttcaacctcaaggccagccgcggcaacgaccgcaatcgcatc
gtactgcctttcagtttcgcctggccgaggtcctacacgttgctggtggaggcatgggat
tccagtaatgacaccgtccaacctgatagcataattgaaaaggcttctcactcgggcatg
atcaaccctagccggcagtggcagacactgaagcagaatacaggggttgcccactttgag
tatcagatccgagtcacctgtgacgaccactattatggctttggctgcaataagttctgt
cggcctagagatgacttttttggacactatgcctgtgaccagaatggtaacaaaacctgc
atggaaggctggatgggccccgagtgcaacaaagctatatgccgacagggctgcagtccc
aagcatggctcctgcaaactcccaggtgactgcaggtgccagtatggttggcagggcctg
tactgcgataagtgcatcccgcacccaggatgtgtccacggcacctgcattgagccttgg
cagtgcctctgtgagaccaactggggagggcagctctgtgacaaagatctcaattactgc
ggaactcaccagccttgtctcaatgggggaacgtgcagcaacaccggtccagacaaatat
cagtgttcctgccctgagggctactccggacccaactgtgaaattgctgagcatgcttgc
ctctctgatccctgccacaacagaggcagctgcagggagacctccttgggctttgagtgt
gagtgttctccaggctggactgggcccacatgttctacaaacattgatgactgttctcca
aataactgttcccatgggggtacctgcgaggacctggtgaacggattcaagtgtgtatgc
cctccccagtggactggcaagacatgtcagttggatgcaaatgagtgcgaggccaaaccc
tgtgtaaatgccagatcctgtaagaatctgattgccagctactactgtgattgtcttcct
ggctggatgggtcaaaactgtgacataaacatcaatgactgccttggccaatgtcagaac
gatgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtttgtgtcccactggtttctctggaaac
ctctgtcagctggatatagattactgtgagcccaacccctgccagaatggtgcccagtgc
tacaatcgtgccagtgactatttctgcaagtgccctgaggactatgaaggcaagaactgc
tcacacctgaaagaccattgtcgcacgaccccctgtgaagtgattgacagctgcactgtg
gccatggcttccaacgacacgcctgaaggggtgcgatatatctcctctaacgtctgtggt
ccccatgggaagtgcaagagccagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcaccggcacctactgtcatgaaaatattaatgactgtgagagcaacccctgtaaaaat
ggtggcacttgcattgatggtgtgaactcctacaagtgtatctgcagtgatggctgggag
ggagcctactgtgaaaccaacatcaatgactgtcgccagaacccctgtcacaatgggggc
acatgtcgagatctggtcaatgacttctactgtgactgcaaaaatggatggaaaggaaag
acctgccactcgcgtgacagccagtgtgacgaagctacatgtaacaatggtggcacctgc
tatgatgaaggggatgcatttaagtgcatgtgtcctggtggctgggaaggaactacctgt
aatatagccagaaacagtagctgtctgccgaacccctgccataatgggggcacctgtgtg
gtcaatggtgaatctttcacatgtgtctgcaaagaaggctgggaggggcccatctgtact
cagaatacaaatgactgcagtcctcatccttgctataatagtggtacttgtgtggatgga
gacaactggtaccggtgtgaatgtgccccaggttttgctggtcctgactgcagaataaac
ataaacgaatgccagtcttcaccttgtgcctttggagccacctgtgtggatgaaatcaat
ggctatcagtgtgtctgcccccctgggcagagtggtgccaagtgccaggaagtttcagga
agatcttgcatcaccatggggagagtgatacctgatggggccaagtgggacgacgactgt
aacacctgccagtgcctgaatggacgggttgcctgctccaaggtctggtgtggccctcga
ccttgcttgcttcacaaagggcacagtgagtgccccagtgggcagagctgcatccccatc
ctggatgaccagtgtttcgtgcgtccctgcactggtgtgggcgagtgtcggtcttctagt
ctccagcccgtgaagaccaagtgtgcctctgactcctattaccaggataattgtgcgaac
atcactttcaccttcaacaaggagatgatgtctccaggtcttaccacagagcacatttgc
agtgaactgaggaatttgaatatcttaaagaatgtttctgctgaatattcaatctacata
gcttgtgagccttccctgtctgcaaacaatgaaatacatgtggccatttctgccgaagat
actcgggatgacggaaaccctatcaaggaaattactgacaaaataatagatcttgttagt
aaacgtgaaggaaacagctcacttattgctgctgttgcagaagtgagagttcagaggcgt
cctctgaagaacagaacagatttcctggttcctctgctgagctctgtcttgacggtggct
tggatctgttgcttggtgacagccttctactggtgtgtacggaagaggcggaagccaaac
agccacactcactcggcctctgaggacaacaccaccaacaatgtgcgggaacagctgaac
cagatcaaaaaccccattgagaagcatggagccaacacggtcccgatcaaggattatgag
aacaaaaactccaaaatgtcaaaaataaggacacacaactctgaagtggaggaggatgac
atggataaacaccagcagaaagcccgcttcgccaaacagccagcatacacgctggtagac
agagaggagaaagcccccaacggcacgccgacaaaacacccgaactggacaaacaaacag
gacaacagagatttggaaagtgcccagagcttgaaccggatggagtacatcgtatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752541
Entry
103752541         CDS       T03372                                 

Gene name
Jag2
Definition
(RefSeq) jagged 2
  KO
K21635  jagged-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04330  Notch signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103752541 (Jag2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103752541 (Jag2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103752541 (Jag2)
  09162 Cancer: specific types
   05224 Breast cancer
    103752541 (Jag2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103752541 (Jag2)
SSDB
Motif
Pfam: EGF hEGF EGF_2 EGF_CA MFS_2
Other DBs
NCBI-GeneID: 103752541
NCBI-ProteinID: XP_008854588
LinkDB
Position
Un
AA seq 1030 aa
MRCTWGVQGSGFSRGHPSLDRMLLRRWLHFPAPSPSPWSCWREATRCSYGWQGKFCDECV
PYPGCVHGSCVEPWHCDCETNWGGLLCDKDLNYCGSHHPCVNGGTCINAEPDQYHCACPE
GYLGKNCERAEHACASNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAG
GTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGIN
CHININDCRGQCQHGGSCKDLVNGYQCVCPRGFGGRHCEIERDECASSPCRRGGICEDLV
DGFRCHCPRGLSGPLCEVDVDLCEPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPREP
CPGGACRVIDGCGFEAGSRAHAVAPSGICGPHGHCVSQPGGNFSCICDSGFTGTYCHENI
DDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDINPNDCLPDPCHSRGRCYDLVNDFY
CACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCTVAKNSSCLP
NPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAP
GFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVVGFGRSCWFRGT
DFPHGSSWMEDCNSCRCLDGHRDCSKVWCGWKPCLLSSQPDTLSAQCPPGQQCREKALGQ
CLQPPCEAWGECTAQEHLLPSTPCLPRSTHLDNNCARLTLRFNRDQVPQGTTVGAICSGI
RALPATRAVARDRLLLLLCDRASSGASAVEVALSFSPARDLPDSSLIQNTAHAIVAAITQ
RGNSSLLLAVTEVKVETVVMGGSSTGLLVPVLCSMFSVLWLACVVICVWWTRKRRKERER
SRLPRDESTNNQWAPLNPIRNPIERPGNSGLGTGAHKDVLYQCKNFTPPPRRAGEALPGP
TGPGASGEDEEEEELGRGDEDSPEAEKFLSHKFTKDPSSSLGKPARWGPGPKVDNRTVRS
TKLVHHAGRE
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcgctgtacctggggagtgcagggctcaggtttcagcagaggacacccctccctggac
cggatgctactgcggagatggctgcactttcctgccccctccccaagcccctggagctgc
tggcgggaagctacaaggtgcagctatggctggcagggcaagttctgtgatgagtgtgtt
ccctaccccggctgtgtgcacggcagctgtgtggagccctggcattgtgactgtgagacc
aactggggtggcctactctgtgacaaagatctgaactactgcggcagccaccacccctgt
gtcaatgggggcacctgtatcaacgctgagcccgatcagtaccactgcgcctgcccagag
ggctacttggggaagaactgcgagcgggctgagcatgcctgtgcctccaacccgtgtgcc
aatgggggttcatgccacgaagtgccatcaggctttgaatgccactgcccgtcgggctgg
agtggacccacctgtgcacttgacatcgatgagtgtgcctccaacccatgtgcagcaggt
ggcacctgtgtggaccaggtggacggctttgagtgcatctgccccgaacagtgggtgggg
gctacctgccagctggacgccaatgagtgtgaagggaagccgtgccttaatgctttttct
tgcaaaaacctgattggcggctattactgtgattgcctcccgggctggaagggcatcaac
tgccacatcaacatcaatgactgtcgtgggcagtgtcagcacggaggctcctgcaaggac
ctggtaaatgggtaccagtgcgtgtgcccacggggctttggaggccggcactgcgagata
gagcgtgacgagtgtgccagcagcccctgccgtcggggcggtatctgcgaggacctggtg
gatggcttccgctgccactgcccacggggcctctctgggccactttgcgaggtggatgtg
gacctctgcgagccgagcccctgcctgaatggtgctcgctgctataacctcgagggtgac
tactactgtgcctgcccagaagactttggtggcaagaactgctcggtgcccagggagccc
tgccctggtggggcctgtagagtgattgatggctgcgggttcgaggcagggtccagggca
catgctgtggcaccctctggcatatgtggccctcatgggcactgtgtcagccagcctggg
ggcaacttctcctgcatctgcgacagcggctttacaggcacctattgtcatgagaacatc
gatgactgcctgggccagccctgccgcaacggaggcacgtgcatcgatgaggtggatgcc
ttccgctgcttctgtcccagtggctgggagggcgagctctgcgacattaatcccaacgac
tgcctccccgacccctgccacagccgcggccgttgctatgatctggtcaatgacttctat
tgtgcctgtgacgatggctggaagggcaagacctgccactctcgcgagttccagtgcgac
gcctatacctgcagcaacggcggcacatgctacgacagtggagataccttccgctgcgcc
tgccctccaggctggaaaggcagcacctgcaccgtagctaagaacagcagctgcctgccc
aacccctgtgtgaatgggggtacctgtgtgggcagtggagactctttctcctgcatctgc
cgggatggctgggagggccgtacctgtacacacaacaccaatgactgcaaccctctaccc
tgctacaacggaggcatctgtgttgatggtgtcaactggttccgctgcgagtgcgcacct
ggctttgcgggtcctgactgtcgcatcaacattgacgagtgccagtcctcaccctgtgcc
tacggggccacctgtgtggatgagatcaacgggtatcgctgcagctgcccaccaggtcga
gccggccccaggtgccaggaagtggttggattcgggaggtcctgctggttccggggcaca
gacttcccgcacgggagctcctggatggaggactgcaacagctgtcgctgcctggatggc
cacagagactgcagcaaggtgtggtgcgggtggaagccttgtctgctgtccagtcagccc
gatactctgagtgcccagtgcccaccggggcagcagtgccgggagaaggccctgggccag
tgtctgcagccgccctgtgaggcctggggtgagtgcacagcacaggaacacctgctgccc
agcaccccttgcctgccacggtccacccacctggacaacaactgtgcacgcctcacgttg
cgctttaaccgagaccaagtgcctcagggcaccaccgtgggcgctatctgctccgggatc
cgtgccttgcctgccaccagggcagtggcgcgcgaccgcctcctactgctgctctgtgat
cgtgcttcctcaggggccagtgctgtggaggtggctttgtccttcagccctgcgagggac
ctgcctgacagcagcctgatccagaacacagctcatgccattgtggctgccatcactcag
cgggggaacagctcgctgctgctggctgtcactgaggtcaaagtggagacagtcgtcatg
ggtggttcctccacaggtctattggtgcctgtgctgtgcagcatgttcagcgtgctgtgg
ctggcctgcgtggtcatctgtgtgtggtggacacgaaagcgcaggaaagagcgtgagagg
agtcggctgccacgggatgaaagcaccaacaaccagtgggccccgctcaatcccatccgc
aaccccatcgagcggccaggcaacagtggcctgggtaccggggcccacaaggacgtgctc
tatcagtgcaagaacttcacgccgccgccacgcagggcgggcgaggcactgcctgggccc
accggccccggggctagtggggaggacgaggaggaagaggagcttggccgcggagatgag
gactccccagaggcagagaagttcctctcacacaaattcaccaaagaccccagcagctcc
ttggggaagccagcccgctggggcccagggcccaaagtggacaaccgcacggtcaggagc
acaaagctagtgcaccatgctggcagggaatag

DBGET integrated database retrieval system