KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729289Help
Entry
103729289         CDS       T03372                                 

Gene name
Eif3a
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103729289 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ngi03012]
    103729289 (Eif3a)
Translation factors [BR:ngi03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    103729289 (Eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 103729289
NCBI-ProteinID: XP_008825541
LinkDB All DBs
Position
Un
AA seq 1390 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLADERHTRLEERKRQRKEERKITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGLPEKEWRRGEARDEDRPHRRDEERPRRLGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGTDDDRPSWRNADDDRPPRRIGDEDRGSWRHADDDRPPRR
GLDDDRPPRRGLDDDRPPRRGLDDDRPPRRGLDDDRPPRRGLDDDRPPRRGLDDDRGSWR
TADEDRGPRRGMDEDRGPRRGGADDERSSWRNADEDRGPRRGMDDDRGPRRGLDDDRGPW
RSADDDRISRRGADDDRGPWRNMDDDRIPRRGDDARPGPWRPFVKPGGWREKEKAREESW
GPPRESRPSEDREWDRDKERERDGQDREENDKDPERDRDRERDGDREDRFRRPRDEGGWR
RGPAEESSSWRDSSRRDERDDRRRERDDRRDLRDLRERRDLRDDRDRRGPPLRSEREEAS
SWRRADDRKEDRTEERDPPRRVPPPALSRDREREREGEREKASWRAEKDREPLRRTKNET
DEDGWTTVRR
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggcccgagaatgccctcaagcgtgccaacgaatttcttgag
gttggcaaaaaacagcctgcgctggatgttctttatgatgttatgaaaagtaagaaacac
agaacatggcagaagatacatgagccaattatgttgaaatacttggaactttgtgtggac
cttcgtaagagccacttggctaaggaaggcttatatcagtataagaacatttgtcaacag
gtaaacattaagtctttagaagatgttgtaagggcttatttgaaattggcagaggaaaaa
actgaggctgccaaagaagaatcccaacaaatggtcctagatatagaagatctggataac
attcaaactcctgagagtgttctcctaagtgctgtaagtggggaagacacccaggatcga
actgacagattacttttgactccctgggttaagttcctgtgggaatcctacaggcagtgt
ttggaccttcttcgaaacaattctagagtagagcgcctttaccatgatattgcccaacaa
gctttcaaattctgcctacaatatactcgtaaggctgagttccgtaaactctgtgacaat
ttgcgaatgcacttatctcagattcagcgtcatcataaccaaagcactgcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccaggcttgttcagctggacagtgct
atcagcatggagctgtggcaggaagccttcaaagctgtggaagatattcatggcctattc
tccttgtctaaaaaaccacctaagcctcagttgatggcaaattactataacaaagtctca
actgtgttttggaaatctggaaatgctctgtttcatgcatctaccctccatcgcctttat
catctgtctagagaaatgaggaagaatcttacacaagaggagatgcagagaatgtctact
agagtccttttggccactctttccatccctattactcccgagcgaaccgatattgctcga
cttttggacatggatggcattatagttgagaaacagcgacgccttgcaacactgctaggt
cttcaagccccacccactcgaattggccttattaatgatatggtaagattcaatgtacta
cagtatgttgtcccagaagtcaaagacctttacaactggttggaagtagaattcaaccca
ctaaagctctgtgagagagtcacaaaggtactgaattgggttagggaacaacctgagaag
gaaccagagttgcaacagtacgtcccacagctgcagaacaacacaatactacgccttctg
cagcaggtggcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagccaggcactgcgacctg
caggttcgtattgatcacacttctcggactctgagttttggatctgacttgaattatgct
actcgagaagatgccccgattggacctcatctgcagagtatgccttcagagcagataaga
aatcagcttacagccatgtcctcagtgcttgcaaaagcacttgaagtcatcaagccagca
catattttgcaagagaaagaagaacagcatcagttggcagtcactgcataccttaaaaat
tcacgaaaagagcatcagcggatcctggctcggcgacagacaattgaggaaagaaaggaa
cgtcttgagagtctgaatatccagcgagagaaagaagagctggagcagagggaggctgaa
ctccagaaagttcggaaggctgaagaagagaggctgcgccaggaggcaaaagagagagag
aaggagcggatcctgcaggagcatgagcaaatcaaaaagaaaactgttcgtgagcggttg
gagcagatcaagaagacagagctgggtgccaaagcattcaaagatattgacatcgaagac
cttgaagaattggatccagattttatcatggccaaacaggttgaacaactggagaaagaa
aagaaggaacttcaagaacgcctgaagaatcaagaaaagaagattgactattttgaaaga
gctaaacgtttggaggaaattcctttgataaagagtgcttatgaggaacagaggattaaa
gacatggatctgtgggagcagcaggaagaagagagaattactacaatgcagctcgaacga
gaaaaggctctggaacataaaaatcgaatgtcaagaatgttggaagacagagatttattt
gtgatgcgactcaaagctgcccgacagtcagtttatgaggaaaaactgaaacaatttgaa
gagcgattagcagacgaaaggcacactcgcttggaagagcggaagaggcagcggaaagaa
gaacgcaagatcacctactatagggaaaaggaggaggaagagcagaggcgggcggaagag
cagatgctgaaagagcgagaagaaagagagcgtgctgagcgagcaaaacgggaggaagaa
cttcgagagtatcaggagcgggtcaagaaacttgaagaagtagaaaggaagaaacgtcaa
agggagttggaaattgaagaaagagaacggcgtagagaggaagagaggagacttggtgat
gacccactttccaggaaggactctcgatggggagatagagattcagaaggcacgtggaga
aaaggaccagaagctgactctgaatggaggagaggcctgccagagaaggagtggagacgt
ggagaagcacgggatgaggacaggcctcataggagagatgaagagcggccaagacgcttg
ggggatgatgaagagagagagtcttctcttaggccagatgatgatcgcattcctagacgt
ggcctggatgatgacagaggccctagacgtggtcctgatgaagatcgcttctctcgtcga
ggaacagatgatgatcgtccttcttggcgtaatgcagacgatgacaggcctcccaggcga
attggtgatgaagacagggggagctggcgtcatgcagacgatgacagaccacccagacga
ggactggatgatgacaggccacccagacgaggactagatgatgacagaccacccagacga
ggactagatgatgacagaccacccagacgaggactagatgatgacagaccacccagacga
ggactagatgatgacagaccacccagacgaggactagatgatgacagaggaagctggcga
acagcagatgaggacagagggcctagacgtgggatggatgaggaccgggggccgaggcga
ggaggtgctgatgatgagcggtcatcctggcgtaatgctgatgaggaccggggtcccagg
cggggcatggatgatgatcggggtcccaggcgagggttggatgatgaccgaggaccttgg
cggagtgctgatgatgataggatttccaggcgtggtgcagatgacgacagggggccttgg
agaaacatggatgatgatcgcattcccagacggggtgatgatgcaagacctggtccctgg
agaccatttgtcaagccaggtggatggagagagaaggaaaaggctagagaagagagctgg
ggtccacctcgagaatcaagaccatcagaagaccgtgaatgggacagagacaaagagagg
gagagagatggtcaagatcgagaggagaatgacaaggatcctgagcgagacagggaccga
gagagagatggggatcgggaggatcgtttcaggagacccagggatgaaggtggctggaga
agaggcccagctgaggaatcttcaagctggagagattcaagtcgccgtgatgagagggat
gaccgtcggcgggagagagatgatcgacgggatctgagagatctcagagaaagacgggat
ttaagagatgacagagaccgcagaggacctcccctcagatcagagcgagaagaagcaagc
tcttggagacgtgctgatgataggaaagaggaccggacagaagagcgagacccacctcgg
cgtgttcctcctccagctctttcaagagatcgagagagagagcgagagggtgagagagag
aaggcttcctggagggctgagaaagatagggaaccacttcgtcgtactaagaatgagacc
gatgaagatgggtggaccactgtgcggcgttaa

DBGET integrated database retrieval system