KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729360Help
Entry
103729360         CDS       T03372                                 

Gene name
Tmprss2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05164  Influenza A
ngi05202  Transcriptional misregulation in cancer
ngi05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    103729360 (Tmprss2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    103729360 (Tmprss2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    103729360 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103729360 (Tmprss2)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103729360 (Tmprss2)
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103729360 (Tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 DUF4418
Motif
Other DBs
NCBI-GeneID: 103729360
NCBI-ProteinID: XP_008825630
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MALNSGSSPGIGPYYENHGYQPEHAYPQRPPVAPNVYQVYPAQDYPSSVPQYAPRVTTHT
STTSVIHRQPKSGEQCTSKTKKALCVTLTLGLVLAGAAVAAGLLWKFLEDKCSESEMECS
SSGKCISSSLWCDGISQCPNGEDENRCVRLYGPSFILQVFSSQRKSWHPVCQDDWNENYG
RAACKDMGYKDSFYFSQGIPDNSGATSFMKLNLSAANIDLYKKLYHSDTCSSRMVVSLRC
IECGVRSVTRQSRIVGGSSASLTEWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPL
NSPRYWTAFAGISRQSLMFYGKRHQVEKVISHPNYDSKTKNNDIALMKLQTPLSFNDVVK
PVCLPNPGMMLDPDQECWISGWGATYEKGSTSDVLNAAMVPLIELSKCNNKYVYNNLITP
AMICAGYIQGTIDSCQGDSGGPLVTWKNSIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYGQMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcatcaccaggtattggaccttactatgaaaaccacgggtac
caacctgagcacgcctacccccaaaggccacctgtggctcctaatgtctaccaagtgtat
ccggctcaggactacccatcttcagtgccccagtacgccccaagggttacaacgcacacc
tcgacaacatctgtcatccacagacagcccaagtcaggagaacagtgcacctcaaagacc
aagaaagcactatgtgtcaccctcacactgggccttgtcctcgcgggtgccgctgtggcc
gccggcttgctttggaagttcttggaagataaatgctctgagtccgagatggagtgcagc
tcttcgggcaagtgcatcagttcctctctctggtgtgatgggatatcgcagtgccccaat
ggggaggacgagaaccggtgtgttcgcctctacggacccagcttcatcctccaggttttc
tcatcacagaggaagtcctggcaccctgtgtgccaggatgactggaatgagaactacggg
agggcggcgtgcaaggacatgggctacaaggacagtttttactttagtcaagggatcccg
gacaacagcggggccacgagcttcatgaaactgaacctcagtgcagccaacattgacctc
tacaagaaactctaccacagcgacacctgttcttcacgcatggtggtttctttgcgctgc
atagagtgtggggtccgctcggtgacccgccagagcaggattgttggtggatcaagtgcc
tccctaacggaatggccctggcaggtcagcctgcatgtgcaaggtgtccatgtctgcgga
gggtccatcatcacccctgagtggatcgtgacagctgcccactgcgtggaagagcccctc
aacagcccaaggtactggacagcattcgcagggatctccagacagtccctcatgttctat
ggaaagaggcaccaggtggaaaaggtgatttcccacccgaattatgactcgaagacaaag
aacaacgacatcgcactcatgaagctgcagacgcctctgtcttttaatgacgtggtgaag
ccggtgtgtctgcccaatccgggcatgatgctggacccagaccaggagtgctggatttca
gggtggggggccacctatgagaaagggtcaacctcggatgtgttgaatgctgccatggtg
cccttgattgagctctcaaaatgtaacaataaatatgtgtataacaacctcatcacacca
gccatgatttgtgcaggttacattcagggcaccatcgactcctgtcagggagacagcgga
gggccactcgtcacttggaaaaacagcatctggtggctgatcggggacacgagctggggc
tcgggctgtgccaaggcatacagaccaggagtgtacgggaacgtgacagtgtttacagac
tggatctacgggcaaatgagggcgaacagctaa

DBGET integrated database retrieval system