KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729385
Entry
103729385         CDS       T03372                                 

Gene name
Ncoa3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04915  Estrogen signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103729385 (Ncoa3)
   04919 Thyroid hormone signaling pathway
    103729385 (Ncoa3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103729385 (Ncoa3)
  09162 Cancer: specific types
   05224 Breast cancer
    103729385 (Ncoa3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103729385 (Ncoa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103729385 (Ncoa3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103729385 (Ncoa3)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103729385 (Ncoa3)
SSDB
Motif
Pfam: NCOA_u2 DUF4927 SRC-1 PAS_11 Nuc_rec_co-act DUF1518 PAS PAS_9 PAS_3 HLH PAS_2 PAS_4 DUF2953
Other DBs
NCBI-GeneID: 103729385
NCBI-ProteinID: XP_008825676
LinkDB
Position
Un
AA seq 1387 aa
MSGLSENSLDPLASDSRKRKLPCDTPGQGLASSAEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTICSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEQDRKDFLKHLPKSTVN
GVSWTNETQRQKSHTFNCRMLMKTTLDTLEDMNASPENRHRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDLIRR
CIQRFFSLIDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTVVSAQTKSKLFRNPVTND
RHGFISTHFLQREQNGYRPNSNPMGQGIRPPAAGCGMNMSPNQSLQMLGNRTYGLADPSN
TGLMSGARYGASGNIASLTPGPGMQSPSSYQNSNYGLSMSSPPHGSPGLGSNQQNIMISP
RNRGSPKMASHQFSPVAGVHSPMGSSGNTASHSFSSSSLSALQAISEGVGTSLLSTLSSP
GPKLDNSPNMNMTQPSKVSNQESKSPLGLYCDQNPVESSVCQSNSREHLSDKESKENSGE
GSENQRGPLETKSHKKLLQLLTCSSDDRGHSSLTNSPLDSGCKDSSIGVTSPSGVSSSTS
GGVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTASCGEGNVKQE
QLSPKKKENNALLRYLLDRDDPSDTLAKELQPQVEGVDHKLSQCSSSTNPGSSQEKDPKI
KTETNEEVSGDLDNLDAILGDLTSSDIYNNPVSTNGSHPGTKQQMFAGSDSLAGLRSPQP
VLSVRPPYTRAVSLDSPVSVGSSPPVKNGNAFPMLPKQPMLGGNPRVIESQENYGANMAG
PNRNVPVNQTPSSGDWGLANSKTSRMEPMSSNSMGRPGDYSASLPRTATGSSVPTLPLRS
NRTPGARPMLQQQQMLQMRTGEVPMGMGVNPYGPAAPSNQPGSWPEGMLSMEQGPHGTQN
RPLLRNSLDDLLGPPSNPEGQNDERALLDQLHTLLSNTDATGLEEIDRALGIPELVSQGQ
ALEPKQDVFQGQEAAVMMDQKAALYAQTFPAQGPPMQGGFNLQGQSPSFNSMINQITQQG
SFALQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQTLEMKMENPTGGGAVIR
PMMQPQGFLNAQMVAQRSRELMSHPLQHPRVAMMMQQPQQQAFSPPPNVTASPSMDGVLA
GPAMPQAPPQQFPYPPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMLQHPQTAPMY
QSSDMKGWPTGNLARNSSFPQQQFAPQGNPAAYSMVHVNSSSGHLGQMNMTSMPMSGMPM
GPDQKYC
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgagtggattaagtgagaactccttggacccactggcgtctgattcacgaaaacgcaaa
ttgccttgtgacactccgggacagggtcttgcctctagtgctgagaagtggagacgagag
caggagagcaagtacatcgaagaactggctgagctgatatctgcaaatcttagtgatatc
gacaattttaatgtcaaaccagataaatgtgcaattttaaaggaaacagtgagacagata
cgtcaaataaaagaacaaggaaaaacaatttgcagtgatgatgatgttcagaaagctgat
gtgtcttctacaggacagggagttattgataaagactctttaggaccacttttacttcag
gcattggatggcttcctgtttgtggtgaatcgagatggaaacattgtatttgtgtcagaa
aacgtcacacaatatctgcaatataagcaggaggacctggttaacacaagtgtctacaat
atcttgcatgaacaagacagaaaggatttccttaaacacttaccaaaatccacagttaat
ggggtttcctggactaatgagacccagagacaaaaaagccatacatttaattgtcgtatg
ctgatgaaaacaacacttgatactttggaagacatgaatgccagtcctgaaaaccgccac
cgatacgaaacaatgcagtgctttgccttgtctcagccgagagctatgatggaggaaggg
gaagacttacaatcctgtatgatctgtgtggcacgccgcattactacaggagaaagaaca
tttccatcaaatcccgagagctttattactagacatgatctttcaggaaaggttgtcaat
atagatacaaattcactgagatcttccatgaggccaggctttgaagatttaatccgaagg
tgtattcagagattctttagtctgattgatgggcagtcatggtctcagaaacgtcactat
caggaagcctatattcatggacatgcagaaaccccagtgtatcgcttctcgttggcggat
ggaactgttgtaagtgcacagacgaaaagcaaactcttccgcaatcctgtgacaaatgat
cgtcatggctttatctcaactcacttccttcagagagagcagaatgggtatagaccaaac
tcaaatcctatgggacaaggcattcgacctcctgcagcaggatgtggcatgaacatgtcc
ccaaaccaaagcttacagatgctaggcaacaggacctatggcttggcagaccccagcaac
acagggctgatgagtggagccaggtatggggcttctggtaacatagcctcactgacccct
gggccaggcatgcagtctccatcttcctaccagaacagcaactatggactcagcatgagc
agccctcctcatggcagtcctggtcttggctccaaccagcagaatatcatgatttctcct
cggaatcgtggcagcccaaagatggcctcacaccagttttctcctgttgcaggtgtgcat
tcacccatgggatcttctggcaatacagcgagccacagcttttccagcagctccctcagt
gccctgcaagccatcagtgagggtgtgggaacttctcttttatctaccctctcttcacca
ggccccaaattggataattctcccaatatgaatatgactcaaccaagtaaagtgagcaat
caggagtccaagagccccctgggcttatactgtgaccagaatccggtggagagttcagtg
tgccagtcaaacagcagagaacaccttagtgacaaagaaagtaaagaaaacagcggggaa
gggtcagagaatcaaaggggtcctttggaaaccaaaagtcataaaaaattgctgcagtta
ctcacctgttcctctgatgaccgaggtcattcatccttgaccaactcccctctggattca
ggttgcaaagactcttccattggtgtcaccagcccctctggagtctcctcctcgacttca
ggaggagtgtcttccacttccaatgtgcatgggtctctgttgcaagagaagcatcggatt
ttgcacaagttgctgcagaatggcaactcaccagcagaagttgccaagattactgcagaa
gccactgggaaggacactagcagcacagcttcttgtggtgaaggaaatgtcaagcaggag
cagctgagtcctaagaagaaagagaataatgcccttctcaggtacctgctggacagggac
gatcctagtgatacgcttgctaaagaactacaaccccaagtggaaggagttgatcataaa
ctgagtcagtgcagcagctccaccaatcctggctcaagtcaagagaaagaccctaaaatt
aagacagagacaaatgaagaggtatctggagacttggataatctagatgctattcttggt
gatctgactagttctgacatttacaacaatcctgtatctacaaatggcagtcatccaggg
accaagcaacaaatgtttgcaggatctgattctctggcaggtttgagaagtccacagcct
gtgctctctgttcgtcctccatacacccgagcagtgtctctggatagcccggtttctgtt
ggctcaagccctccagtaaagaatggcaatgctttccccatgttaccaaaacaacccatg
ttgggtgggaatccaagagtgatagagagtcaggaaaattatggagcaaatatggctgga
ccaaacagaaatgttcctgtgaaccagaccccttcctcaggagactggggcttagcaaac
tcaaagaccagcagaatggaacctatgagttcaaattccatgggaagaccgggagattac
agtgcttctttaccaagaactgccacagggagctcagtgcctaccttgccacttcgatcc
aatagaaccccaggtgcaaggccaatgctgcagcagcagcaaatgcttcaaatgaggact
ggtgaggttcccatgggaatgggggtcaatccctatggcccagcggcaccatctaatcaa
ccaggctcctggccagagggcatgctgtctatggaacaaggtccacatgggactcaaaat
aggcctcttcttagaaattccttggatgatctccttgggcccccctctaacccagaaggc
cagaatgatgaaagagcactgttggaccagctgcacacactcttaagcaatacggatgct
acaggcctggaggaaattgacagagcgttgggtatccctgaacttgtaagtcagggacaa
gctttggagcccaaacaggatgttttccaaggccaagaagcagcagttatgatggatcag
aaggctgcactgtatgcacagacgttcccagcccaggggcctccaatgcaagggggtttt
aatcttcagggacagtcaccatcttttaattctatgataaatcagattacccagcaaggc
agttttgctctccaaggaatgcatcctagagccaacatcatgagaccaaggacaaacacc
ccgaagcaactgagaatgcaacttcagcagaggctgcagggccagcagtttctgaatcag
agccgacagacccttgaaatgaaaatggaaaaccccactggtggtggtgctgtgataagg
cccatgatgcagccccagggcttcttaaatgcccagatggttgcccagcgcagcagagag
ctgatgagccatcccctccagcacccaagagtggctatgatgatgcagcagccacagcaa
caggccttcagcccgcctccgaacgtcactgcatcccctagcatggatggggttttggca
ggacctgcgatgccacaagccccaccacagcagtttccttatccaccaaattacggaatg
ggacaacaaccagatccagcctttggtcgagtatctagtcctcctaatgcaatgatgtca
tcaagaatgggtccctcccagaatcccatgctgcagcatcctcagactgcacccatgtat
cagtcttcagacatgaaggggtggccaacgggaaacttggccaggaacagctcctttcct
cagcagcagtttgctccccaggggaaccctgcagcatacagtatggtgcacgtgaacagc
agcagtggtcacctgggacagatgaacatgacctccatgcccatgtctggcatgcccatg
ggtcctgatcagaaatactgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746491
Entry
103746491         CDS       T03372                                 

Gene name
Ncoa1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04915  Estrogen signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05200  Pathways in cancer
ngi05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103746491 (Ncoa1)
   04919 Thyroid hormone signaling pathway
    103746491 (Ncoa1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746491 (Ncoa1)
  09162 Cancer: specific types
   05224 Breast cancer
    103746491 (Ncoa1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103746491 (Ncoa1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103746491 (Ncoa1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103746491 (Ncoa1)
SSDB
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_12
Other DBs
NCBI-GeneID: 103746491
NCBI-ProteinID: XP_008846907
LinkDB
Position
Un
AA seq 1443 aa
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEAARRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRINPSVNPSISPALGVARSSTLPPSNNSMVSARVNR
QQSSDLNSSSSHGNSNNHQGSFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNSSPMEGT
GISLAQFMSPRRQVTSGLATRARMPNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVT
SLQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLSMQPAKAESKDNKEIASILNEMIQSD
NSASDGKPLDSGLMHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSSSASSNSSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTST
SVSVTGQTQGNSSVKLELDASKKKDSKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEK
KEQMDPCNTNPTPITKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETDRMD
GAVTNVNIKSEILPASLQSTTARPTSRLNRLPELELETIDNQFTQPGTGDQIPWTNNAVT
TVNQNKPEDQCITSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGI
DKLVQGGGLDVLSERFPPQQATPPLMMEERPTLYSQPYSSPSPTASLPSPFQGMVRQKPS
LGTMPVQVTPPRGTFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAIL
NQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQRAMLMRQQ
SFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASL
ATRSSMVNRGMAGNMGGQFSTGINPQMQQNVFQYPGSGLVPQGEASFAPSLSPGSSMVPM
PIPPPQSSLLQQTPPTSGYQSPDMKAWQQGTIGSNSVFSQAVQNQPTPAQPGVYNNMSIT
VSMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPDQMNDPSLRHTGLYCNQLSSTDLLK
TEADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQL
LTE
NT seq 4332 nt   +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatcggaccctgcaaacccagactcgcataagagaaaa
ggatcgccatgtgacacactggcatcgagcactgaaaagagacgcagggagcaagaaaat
aaatatttagaagaactagccgaattactgtcagccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttaggccctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaaccaggaggaattaatgaataccagtgtctacagcatactg
cacgtgggagatcatgcagaatttgtcaagaatctgctacccaaatcactagtaaatgga
gttccttggcctcaagaggcagcacgccgaaatagccatacttttaactgcagaatgcta
attcaccctccagacgaaccaggtactgagaaccaagaagcttgccaacgttatgaagta
atgcagtgtttcaccgtgtcacaaccaaaatcaattcaagaagatggagaagatttccag
tcatgtttaatttgtattgcacggcgattacctcgacctccagctattacaggtgtagaa
tcctttatgaccaaacaagatactacaggtaaaatcatctccattgatactagctccctg
agagctgctggcagaactggctgggaagatttagtaaggaaatgcatttatgcgtttttc
caacctcagggcagagaaccatcttatgcccgacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctggt
atgtcaattccccgaataaacccctccgtcaatcctagtatctctccagctcttggtgtg
gcccgttcatccacattgccaccatccaacaacagcatggtctctgccagagtaaaccgc
caacagagctcagatcttaacagcagcagcagtcatggtaattcaaacaaccaccaaggg
agttttggatgctcacctggaaatcagattgtagccaatgttgccttaaaccagggacag
gcaggttctcagagcagtaatccctctttaaacctcaacagttctcctatggaaggtaca
ggaatttcccttgcacagttcatgtctccaaggagacaggttacctctggcttggcaaca
agggccagaatgccaaacaattcatttcctccaaatattccaacattaagctccccagtt
ggcattacaagtggtgcctgtaataataataatcgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctgccagttctcca
gtcctcaggcagatgagttcacagaattcacctagcagattaagtatgcaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccattttaaatgaaatgattcaatcggac
aacagcgctagtgatggtaaacctctggattcaggacttatgcataacaacgacagactt
tcagatggagacagtaaatactctcaaactagtcacaaactagtgcagctattgacaaca
actgcagaacagcagttacggcatgccgatatagacacaagctgcaaggatgtactgtct
tgcacaggcacttccagctctgcttcttctaactcttcaggaggtacttgcccctcctct
catagctctctgactgagcggcacaaaattctgcaccggcttttacaggagggtagcccc
tcagatatcaccactttgtctgtggaacctgacaaaaaggacagtgcatcaacttccact
tctgtgtcagtgactggacaaacccaagggaactctagtgtaaaactagaactggatgct
tcaaagaaaaaggactcaaaagaccatcagctcctacgttatcttttagacaaagatgag
aaagatttaagatcaactccaaacctgagcctggatgatgtaaaggtaaaagtggaaaaa
aaagaacagatggatccttgtaatacaaacccaactccaataaccaaacctgctcctgag
gaagttaagctggagtcccagagtcagtttacagctgaccttgaccagtttgatcagttg
ctgcccacactggagaaggcagcacagttgccaagcttatgtgagacagacaggatggat
ggtgctgtcaccaatgtaaacatcaaatcagagatcctgccagcttcactccagtccacc
actgccagacccacttcccgactgaacagattgcctgaactagaattagaaacaattgat
aaccagtttacacaacccggaactggcgatcagattccatggacaaataatgctgtgaca
actgtaaatcagaacaagccagaagaccaatgtattacttcacaattagatgagcttctc
tgtccaccaacaacagtagaaggaagaaatgatgagaaggctcttctggaacaactagtg
tccttcctcagtggcaaagatgaaactgagctggctgaactggacagagccctgggaatt
gacaaacttgttcaggggggaggattagatgtattatcagagagatttccaccacaacaa
gcaacaccacctttgatgatggaagaaagacccaccctctattcccagccatactcatct
ccttctcctactgccagcctccctagccctttccaaggcatggtcaggcagaagccttca
ctggggactatgcctgttcaggtaacacctcccaggggcactttttcacccggcatgggc
atgcagccccgacaaactctcaacagacctccagctgcacctaaccaacttcgacttcaa
ctacagcagcggttacagggacaacagcagttgatacaccaaaaccggcaagctatcctg
aatcagtttgcagcaactgctcctgttggtatcaacatgagatcaggcatgcaacaacaa
attacacctcagccacccctgaatgctcaaatgttggcacagcgtcagcgggagttgtac
agtcagcagcatcgacagaggcagctaatacagcaaagagccatgctcatgaggcagcaa
agctttgggaacaacctccctccctcatctggactgccagttcaaatggggaatccccgt
cttcctcagggtgctccacagcaattcccctacccaccaaactatggtacaaacccagga
accccgccagcttctaccagccccttttctcaactcgcagcaaatcctgaagcatcctta
gccacccgcagcagcatggtgaacagaggcatggcaggaaacatgggaggacagtttagt
actggaatcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggactggtt
ccacaaggtgaggccagctttgccccatctctaagccctgggagctccatggtgccaatg
ccaatccctcctcctcaaagctctctgctccaacaaactccgcccacgtctggataccag
tcaccagacatgaaggcctggcagcaaggaacaataggaagcaacagtgtattcagtcaa
gctgtccagaaccaacccacacctgcacaaccaggagtatacaacaacatgagcatcacg
gtgtccatggcaggtggaaatacaaacgttcaaaacatgaacccaatgatgggccagatg
cagatgagctctttgcagatgccaggaatgaatactgtgtgccctgatcagatgaatgat
ccatcattgagacacacaggcctctactgcaaccagctctcatctactgaccttctcaaa
acagaagcagatgggaaccagcaggtgcaacaggttcaggtgtttgctgacgtccaatgt
acagtgaatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaa
aaacccacgtcaggaccacagaccccccaagcccagcagaagagtctccttcagcagcta
ctgactgaataa

DBGET integrated database retrieval system