KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729666
Entry
103729666         CDS       T03372                                 

Gene name
Prkcg
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04150  mTOR signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04613  Neutrophil extracellular trap formation
ngi04650  Natural killer cell mediated cytotoxicity
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103729666 (Prkcg)
   04012 ErbB signaling pathway
    103729666 (Prkcg)
   04014 Ras signaling pathway
    103729666 (Prkcg)
   04015 Rap1 signaling pathway
    103729666 (Prkcg)
   04310 Wnt signaling pathway
    103729666 (Prkcg)
   04370 VEGF signaling pathway
    103729666 (Prkcg)
   04066 HIF-1 signaling pathway
    103729666 (Prkcg)
   04020 Calcium signaling pathway
    103729666 (Prkcg)
   04070 Phosphatidylinositol signaling system
    103729666 (Prkcg)
   04071 Sphingolipid signaling pathway
    103729666 (Prkcg)
   04150 mTOR signaling pathway
    103729666 (Prkcg)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103729666 (Prkcg)
   04540 Gap junction
    103729666 (Prkcg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103729666 (Prkcg)
   04650 Natural killer cell mediated cytotoxicity
    103729666 (Prkcg)
   04666 Fc gamma R-mediated phagocytosis
    103729666 (Prkcg)
   04670 Leukocyte transendothelial migration
    103729666 (Prkcg)
  09152 Endocrine system
   04911 Insulin secretion
    103729666 (Prkcg)
   04929 GnRH secretion
    103729666 (Prkcg)
   04921 Oxytocin signaling pathway
    103729666 (Prkcg)
   04935 Growth hormone synthesis, secretion and action
    103729666 (Prkcg)
   04918 Thyroid hormone synthesis
    103729666 (Prkcg)
   04919 Thyroid hormone signaling pathway
    103729666 (Prkcg)
   04928 Parathyroid hormone synthesis, secretion and action
    103729666 (Prkcg)
   04916 Melanogenesis
    103729666 (Prkcg)
   04925 Aldosterone synthesis and secretion
    103729666 (Prkcg)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103729666 (Prkcg)
  09154 Digestive system
   04970 Salivary secretion
    103729666 (Prkcg)
   04971 Gastric acid secretion
    103729666 (Prkcg)
   04972 Pancreatic secretion
    103729666 (Prkcg)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103729666 (Prkcg)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103729666 (Prkcg)
  09156 Nervous system
   04724 Glutamatergic synapse
    103729666 (Prkcg)
   04727 GABAergic synapse
    103729666 (Prkcg)
   04725 Cholinergic synapse
    103729666 (Prkcg)
   04728 Dopaminergic synapse
    103729666 (Prkcg)
   04726 Serotonergic synapse
    103729666 (Prkcg)
   04720 Long-term potentiation
    103729666 (Prkcg)
   04730 Long-term depression
    103729666 (Prkcg)
   04723 Retrograde endocannabinoid signaling
    103729666 (Prkcg)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103729666 (Prkcg)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103729666 (Prkcg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103729666 (Prkcg)
   05206 MicroRNAs in cancer
    103729666 (Prkcg)
   05205 Proteoglycans in cancer
    103729666 (Prkcg)
   05231 Choline metabolism in cancer
    103729666 (Prkcg)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103729666 (Prkcg)
   05214 Glioma
    103729666 (Prkcg)
   05223 Non-small cell lung cancer
    103729666 (Prkcg)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103729666 (Prkcg)
   05022 Pathways of neurodegeneration - multiple diseases
    103729666 (Prkcg)
  09165 Substance dependence
   05031 Amphetamine addiction
    103729666 (Prkcg)
   05032 Morphine addiction
    103729666 (Prkcg)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103729666 (Prkcg)
   05161 Hepatitis B
    103729666 (Prkcg)
   05171 Coronavirus disease - COVID-19
    103729666 (Prkcg)
   05163 Human cytomegalovirus infection
    103729666 (Prkcg)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103729666 (Prkcg)
   05143 African trypanosomiasis
    103729666 (Prkcg)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103729666 (Prkcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103729666 (Prkcg)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103729666 (Prkcg)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103729666 (Prkcg)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 103729666
NCBI-ProteinID: XP_008825950
LinkDB
Position
Un
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcgggactgggccccggcggaggcgactcagaggggggaccccgacccctgttttgc
agaaagggggcgctgaggcagaaggtggttcacgaggtcaagagccacaagttcaccgct
cgcttcttcaagcaaccaaccttctgcagtcactgtaccgactttatctggggtattgga
aaacagggcctgcaatgtcaagtctgcagctttgtcgttcatcgccgatgccacgaattc
gtgaccttcgagtgtccaggcgctggaaagggcccccagacggacgacccccgaaacaag
cacaagttccgcctgcacagctacagcagccccaccttctgtgaccactgtggctccctc
ctctacgggctggtgcaccagggcatgaaatgttcctgctgcgagatgaacgtgcacaga
cgctgtgtgcgcagcgtgccctccctgtgtggtgtggaccacacggagcgccgtgggcgt
ctgcagctggaaatccgggctcccacggctgatgagatccacatcacggttggtgaggcc
cggaacctcattcccatggaccccaatggtctgtctgatccctacgtgaagctgaagctc
attccagaccctcggaacttgacaaagcagaagacacggacggtgaaagccacactgaac
cccgtgtggaacgagaccttcgtgttcaacctgaagccaggggatgtggagcgacggctc
agtgtggaggtgtgggactgggataggacttcgcgaaatgacttcatgggagccatgtcc
tttggtgtctcagagctgctcaaggcccctgtggatggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtaccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaattaccccttggaactgtatgagagagtgcggatgggcccctct
tcctcccccatcccctccccatcccccagtcccaccgactccaagcgctgtttctttggt
gccagccctggacgcctgcacatctctgacttcagcttcctcatggttctagggaaaggc
agtttcgggaaggtgatgctggctgaacgcagaggctctgatgaactctacgccatcaag
atcctgaaaaaagatgtcattgtccaggatgatgatgtggactgcaccctagtggagaag
cgggtgctggcactaggaggccgaggtcctggaggccggccccacttcctcacacagctc
cattccaccttccagacaccggaccgcttgtatttcgtgatggagtatgtcaccgggggc
gatttaatgtaccacattcagcagctgggcaagtttaaggaaccacatgcagcgttctat
gcagcagaaatcgccattggcctcttcttccttcacaatcagggcatcatctacagggac
ctcaagttggataatgtgatgctggatgctgaagggcacatcaagatcacagactttggc
atgtgtaaagagaatgtcttcccggggtccacaacccgcacattctgtggaaccccagac
tacatagcacctgagatcattgcctatcagccctatggaaagtcagttgactggtggtct
tttggggtcctgctgtatgagatgttggcaggacagccgccctttgatggggaggatgaa
gaggagcttttccaggccatcatggagcaaactgtcacctaccccaagtcactttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcatccaggaaagcgcttgggctca
gggccggatggcgagcccaccatccgtgcacatggctttttccgctggatcgactgggag
aggctggagcgattggagattgcccctccattcagaccacgcccgtgtggccgcagtggc
gaaaacttcgataagtttttcacacgggcagctccagctctgacccctccagaccgcctg
gttctggccagcatcgaccaggcggacttccagggcttcacttacgtgaatcctgacttt
gtgcacccagatgcccgcagccccaccagcccagtgcccgtgccagtcatgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742202
Entry
103742202         CDS       T03372                                 

Gene name
Prkca
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04613  Neutrophil extracellular trap formation
ngi04650  Natural killer cell mediated cytotoxicity
ngi04664  Fc epsilon RI signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103742202 (Prkca)
   04012 ErbB signaling pathway
    103742202 (Prkca)
   04014 Ras signaling pathway
    103742202 (Prkca)
   04015 Rap1 signaling pathway
    103742202 (Prkca)
   04310 Wnt signaling pathway
    103742202 (Prkca)
   04370 VEGF signaling pathway
    103742202 (Prkca)
   04066 HIF-1 signaling pathway
    103742202 (Prkca)
   04020 Calcium signaling pathway
    103742202 (Prkca)
   04070 Phosphatidylinositol signaling system
    103742202 (Prkca)
   04072 Phospholipase D signaling pathway
    103742202 (Prkca)
   04071 Sphingolipid signaling pathway
    103742202 (Prkca)
   04151 PI3K-Akt signaling pathway
    103742202 (Prkca)
   04150 mTOR signaling pathway
    103742202 (Prkca)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103742202 (Prkca)
   04540 Gap junction
    103742202 (Prkca)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103742202 (Prkca)
   04650 Natural killer cell mediated cytotoxicity
    103742202 (Prkca)
   04664 Fc epsilon RI signaling pathway
    103742202 (Prkca)
   04666 Fc gamma R-mediated phagocytosis
    103742202 (Prkca)
   04670 Leukocyte transendothelial migration
    103742202 (Prkca)
  09152 Endocrine system
   04911 Insulin secretion
    103742202 (Prkca)
   04929 GnRH secretion
    103742202 (Prkca)
   04912 GnRH signaling pathway
    103742202 (Prkca)
   04921 Oxytocin signaling pathway
    103742202 (Prkca)
   04926 Relaxin signaling pathway
    103742202 (Prkca)
   04935 Growth hormone synthesis, secretion and action
    103742202 (Prkca)
   04918 Thyroid hormone synthesis
    103742202 (Prkca)
   04919 Thyroid hormone signaling pathway
    103742202 (Prkca)
   04928 Parathyroid hormone synthesis, secretion and action
    103742202 (Prkca)
   04916 Melanogenesis
    103742202 (Prkca)
   04925 Aldosterone synthesis and secretion
    103742202 (Prkca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103742202 (Prkca)
   04270 Vascular smooth muscle contraction
    103742202 (Prkca)
  09154 Digestive system
   04970 Salivary secretion
    103742202 (Prkca)
   04971 Gastric acid secretion
    103742202 (Prkca)
   04972 Pancreatic secretion
    103742202 (Prkca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103742202 (Prkca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103742202 (Prkca)
  09156 Nervous system
   04724 Glutamatergic synapse
    103742202 (Prkca)
   04727 GABAergic synapse
    103742202 (Prkca)
   04725 Cholinergic synapse
    103742202 (Prkca)
   04728 Dopaminergic synapse
    103742202 (Prkca)
   04726 Serotonergic synapse
    103742202 (Prkca)
   04720 Long-term potentiation
    103742202 (Prkca)
   04730 Long-term depression
    103742202 (Prkca)
   04723 Retrograde endocannabinoid signaling
    103742202 (Prkca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103742202 (Prkca)
  09158 Development and regeneration
   04360 Axon guidance
    103742202 (Prkca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103742202 (Prkca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742202 (Prkca)
   05206 MicroRNAs in cancer
    103742202 (Prkca)
   05205 Proteoglycans in cancer
    103742202 (Prkca)
   05231 Choline metabolism in cancer
    103742202 (Prkca)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103742202 (Prkca)
   05214 Glioma
    103742202 (Prkca)
   05223 Non-small cell lung cancer
    103742202 (Prkca)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103742202 (Prkca)
   05022 Pathways of neurodegeneration - multiple diseases
    103742202 (Prkca)
  09165 Substance dependence
   05031 Amphetamine addiction
    103742202 (Prkca)
   05032 Morphine addiction
    103742202 (Prkca)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103742202 (Prkca)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103742202 (Prkca)
   05161 Hepatitis B
    103742202 (Prkca)
   05171 Coronavirus disease - COVID-19
    103742202 (Prkca)
   05164 Influenza A
    103742202 (Prkca)
   05163 Human cytomegalovirus infection
    103742202 (Prkca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103742202 (Prkca)
   05143 African trypanosomiasis
    103742202 (Prkca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103742202 (Prkca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103742202 (Prkca)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103742202 (Prkca)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103742202 (Prkca)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103742202 (Prkca)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103742202 (Prkca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 103742202
NCBI-ProteinID: XP_008841422
LinkDB
Position
Un
AA seq 672 aa
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVINPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPRVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgtctacccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcagataagggaccggacactgatgaccccaggagc
aagcacaagttcaaaatccacacgtatgggagccccactttctgcgatcactgtgggtca
ttgctgtatggacttatccaccaagggatgaaatgtgacacctgcgacatgaacgttcac
aagcagtgtgtgatcaatgtccccagcctctgcggaatggatcacacagagaagaggggg
cgaatttatctgaaggctgaagtcactgatgaaaagctccatgtcacagtacgagatgca
aaaaatttaatccctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagtaaacagaaaaccaaaaccatccgctccacactaaac
cctcagtggaatgagtccttcacattcaaattaaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggattgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggcgtttcagagctgatgaagatgccagccagtggatggtacaagttgctcaaccaa
gaagagggtgaatactacaatgtgcccatcccggagggggatgaagaaggcaacgtggag
ctcaggcagaaatttgagaaagccaagcttggccctgctggtaacaaagtcatcaaccct
tcagaagacaggaagcaaccctccaacaaccttgacagagtgaaactcactgacttcaat
ttcctcatggtgctggggaaggggagttttgggaaggtgatgctcgctgacaggaaggga
acagaagagctgtatgccatcaagatcttgaagaaggatgtggtgatccaggatgatgat
gtggagtgcaccatggtagaaaagcgggtccttgctttgctcgacaagcccccattcctg
acgcagctgcactcctgcttccagacagtggaccgactgtactttgtcatggaatacgtc
aacggcggggacctcatgtaccacattcaacaagtaggaaaatttaaggagccacaagca
gtattctatgcagcagagatttccattggattgttctttcttcataaaagaggaatcatt
tacagggatttgaagttagacaacgtcatgctggactcagaaggacacatcaaaatcgcc
gactttgggatgtgcaaggaacacatgatggatggagtcacaaccaggacattctgtggg
actcctgattacatagccccagagatcatcgcttaccagccgtatggaaaatctgtggac
tggtgggcgtacggcgtgctattgtatgaaatgctagcaggacagcctccatttgatggt
gaagatgaggacgaactgtttcagtctataatggagcacaacgtgtcctaccccaaatcc
ttgtctaaagaggctgtttccatctgcaaaggacttatgaccaaacacccagccaagcga
ctaggctgcgggcccgagggagagagagatgtcagagaacatgccttcttccggaggatc
gactgggaaaaactggagaatagggagatccagccaccattcaaacccagagtgtgtggt
aaaggagcagaaaactttgacaaattcttcacacgagggcagcccgtcttaacgccgcca
gatcagctagtcatcgctaatatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcacccgatcttgcaaagtgcagtatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746928
Entry
103746928         CDS       T03372                                 

Gene name
Prkcb
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04070  Phosphatidylinositol signaling system
ngi04071  Sphingolipid signaling pathway
ngi04150  mTOR signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04310  Wnt signaling pathway
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04613  Neutrophil extracellular trap formation
ngi04650  Natural killer cell mediated cytotoxicity
ngi04662  B cell receptor signaling pathway
ngi04666  Fc gamma R-mediated phagocytosis
ngi04670  Leukocyte transendothelial migration
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04919  Thyroid hormone signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04931  Insulin resistance
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04973  Carbohydrate digestion and absorption
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05140  Leishmaniasis
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103746928 (Prkcb)
   04012 ErbB signaling pathway
    103746928 (Prkcb)
   04014 Ras signaling pathway
    103746928 (Prkcb)
   04015 Rap1 signaling pathway
    103746928 (Prkcb)
   04310 Wnt signaling pathway
    103746928 (Prkcb)
   04370 VEGF signaling pathway
    103746928 (Prkcb)
   04064 NF-kappa B signaling pathway
    103746928 (Prkcb)
   04066 HIF-1 signaling pathway
    103746928 (Prkcb)
   04020 Calcium signaling pathway
    103746928 (Prkcb)
   04070 Phosphatidylinositol signaling system
    103746928 (Prkcb)
   04071 Sphingolipid signaling pathway
    103746928 (Prkcb)
   04150 mTOR signaling pathway
    103746928 (Prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103746928 (Prkcb)
   04540 Gap junction
    103746928 (Prkcb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103746928 (Prkcb)
   04650 Natural killer cell mediated cytotoxicity
    103746928 (Prkcb)
   04662 B cell receptor signaling pathway
    103746928 (Prkcb)
   04666 Fc gamma R-mediated phagocytosis
    103746928 (Prkcb)
   04670 Leukocyte transendothelial migration
    103746928 (Prkcb)
   04062 Chemokine signaling pathway
    103746928 (Prkcb)
  09152 Endocrine system
   04911 Insulin secretion
    103746928 (Prkcb)
   04929 GnRH secretion
    103746928 (Prkcb)
   04912 GnRH signaling pathway
    103746928 (Prkcb)
   04921 Oxytocin signaling pathway
    103746928 (Prkcb)
   04935 Growth hormone synthesis, secretion and action
    103746928 (Prkcb)
   04918 Thyroid hormone synthesis
    103746928 (Prkcb)
   04919 Thyroid hormone signaling pathway
    103746928 (Prkcb)
   04928 Parathyroid hormone synthesis, secretion and action
    103746928 (Prkcb)
   04916 Melanogenesis
    103746928 (Prkcb)
   04925 Aldosterone synthesis and secretion
    103746928 (Prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103746928 (Prkcb)
  09154 Digestive system
   04970 Salivary secretion
    103746928 (Prkcb)
   04971 Gastric acid secretion
    103746928 (Prkcb)
   04972 Pancreatic secretion
    103746928 (Prkcb)
   04973 Carbohydrate digestion and absorption
    103746928 (Prkcb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103746928 (Prkcb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103746928 (Prkcb)
  09156 Nervous system
   04724 Glutamatergic synapse
    103746928 (Prkcb)
   04727 GABAergic synapse
    103746928 (Prkcb)
   04725 Cholinergic synapse
    103746928 (Prkcb)
   04728 Dopaminergic synapse
    103746928 (Prkcb)
   04726 Serotonergic synapse
    103746928 (Prkcb)
   04720 Long-term potentiation
    103746928 (Prkcb)
   04730 Long-term depression
    103746928 (Prkcb)
   04723 Retrograde endocannabinoid signaling
    103746928 (Prkcb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103746928 (Prkcb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103746928 (Prkcb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746928 (Prkcb)
   05206 MicroRNAs in cancer
    103746928 (Prkcb)
   05205 Proteoglycans in cancer
    103746928 (Prkcb)
   05231 Choline metabolism in cancer
    103746928 (Prkcb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103746928 (Prkcb)
   05214 Glioma
    103746928 (Prkcb)
   05223 Non-small cell lung cancer
    103746928 (Prkcb)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103746928 (Prkcb)
   05022 Pathways of neurodegeneration - multiple diseases
    103746928 (Prkcb)
  09165 Substance dependence
   05031 Amphetamine addiction
    103746928 (Prkcb)
   05032 Morphine addiction
    103746928 (Prkcb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103746928 (Prkcb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103746928 (Prkcb)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103746928 (Prkcb)
   05161 Hepatitis B
    103746928 (Prkcb)
   05171 Coronavirus disease - COVID-19
    103746928 (Prkcb)
   05164 Influenza A
    103746928 (Prkcb)
   05163 Human cytomegalovirus infection
    103746928 (Prkcb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103746928 (Prkcb)
   05140 Leishmaniasis
    103746928 (Prkcb)
   05143 African trypanosomiasis
    103746928 (Prkcb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103746928 (Prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103746928 (Prkcb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103746928 (Prkcb)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103746928 (Prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 103746928
NCBI-ProteinID: XP_008847433
LinkDB
Position
Un
AA seq 671 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKVPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccaatgtcaagtctgctgctttgttgtgcacaagcgctgccatgaa
tttgtcacattctcctgccctggcgccgacaaaggcccagcctctgatgacccccggagc
aaacacaagtttaagatccacacctactccagccctaccttttgtgaccactgtgggtcc
ctgctgtatggacttattcaccaggggatgaaatgtgacacctgcatgatgaacgtccat
aagcgctgtgtgatgaatgtccccagcctctgtggcactgaccacacggagcgccgtggc
cgtatctacatccaggcccacatcgacagggaggtcctcatcgttgttgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagatccctatgtgaagctgaaactg
atccctgatcccaaaagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaat
ccagagtggaacgagaccttcagatttcagctgaaagaatcagacaaagacagaagactg
tcggttgagatctgggactgggacctgaccagcaggaatgatttcatggggtctctgtct
tttgggatttcagaactgcagaaagctggcgtggatggctggttcaagttactgagccag
gaagagggcgagtacttcaacgtgcctgtgccaccagaaggaagtgagggcaacgaagag
ctgcggcagaaatttgagagagccaagatcggccagggtaccaaggttccagaagaaaag
acgaccaataccatctccaaatttgataacaatggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctgggaaaggggagctttggcaaggtcatgctctcagaa
cggaagggcacagatgagctctatgctgtgaagatcttgaagaaagatgtggtgatccag
gacgatgatgtggagtgcacaatggtggagaagcgggtgctggccctgcctgggaagccg
ccattcctgacacagctgcactcctgtttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaacgggggtgacctcatgtaccacatccaacaagttggccgattcaaggag
cctcacgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggtatcatttaccgtgacctaaaactcgacaacgtgatgctggattccgaggggcacatc
aaaatcgctgactttggcatgtgtaaggagaacatctgggatggggtaacaaccaagaca
ttttgtggcaccccagactacattgccccagagatcattgcttatcagccctatgggaag
tctgtggattggtgggcctttggagtcctgctgtatgaaatgttggctgggcaggcacct
tttgaaggggaagatgaggatgaactcttccagtccatcatggagcacaatgtggcttat
cccaagtccatgtcaaaggaagctgtggccatctgcaaagggctaatgaccaaacaccca
ggcaaacgtctgggttgcggacccgaaggagaacgagacattaaagagcacgcatttttc
cggtatattgactgggagaaacttgaacgcaaagagattcagccaccgtataaaccgaaa
gctagagacaagcgagacacctccaacttcgacaaagagttcaccaggcagcctgtggaa
ctgactcccactgacaaactattcatcatgaacttggaccaaaatgagtttgctggcttc
tcgtatactaacccagagtttgtcattaacgtgtag

DBGET integrated database retrieval system