KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729731Help
Entry
103729731         CDS       T03372                                 

Gene name
Hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00051  Fructose and mannose metabolism
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi00520  Amino sugar and nucleotide sugar metabolism
ngi00524  Neomycin, kanamycin and gentamicin biosynthesis
ngi01100  Metabolic pathways
ngi01200  Carbon metabolism
ngi04066  HIF-1 signaling pathway
ngi04910  Insulin signaling pathway
ngi04930  Type II diabetes mellitus
ngi04973  Carbohydrate digestion and absorption
ngi05230  Central carbon metabolism in cancer
Module
ngi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ngi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103729731 (Hk1)
   00051 Fructose and mannose metabolism
    103729731 (Hk1)
   00052 Galactose metabolism
    103729731 (Hk1)
   00500 Starch and sucrose metabolism
    103729731 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    103729731 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103729731 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103729731 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103729731 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103729731 (Hk1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103729731 (Hk1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103729731 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103729731 (Hk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103729731 (Hk1)
Membrane trafficking [BR:ngi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103729731 (Hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Sec23_helical
Motif
Other DBs
NCBI-GeneID: 103729731
NCBI-ProteinID: XP_008826029
LinkDB All DBs
Position
Un
AA seq 973 aa AA seqDB search
MPRLGCCGGGAKRGGGGGGGGGGGAAELPSEDHCSPGLRRSHRPHVCFPAPPTATMIAAQ
LLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDILTRFKKEMKNGLSRDYNPTASVKMLP
TFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVNMESEAYETPENIVHGSGSQ
LFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADV
VKLLNKSIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHI
DLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGLYIGEL
VRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEQNKEGIQNAREILTRLGVEPSD
DDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSR
RFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLARFRLTKQTLL
EVKKRMRVEMDLGLSKQTHDKATVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRVLLVKI
RSGKKRTVEMHNKIYSIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFP
CKQTSLDCGILITWTKGFKASDCVGHDVATLLRDAIKRREEFDLDVVAMVNDTVGTMMTC
AYEEPSCEVGLIVGTGSNACYMEEMRNVEVLEGNQGQMCINMEWGAFGDNGCMDDIRTEY
DRVVDEFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETK
FLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVEKI
RENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCSVSFLLSEDGSGKGAALIT
AVGVRLRGEITSS
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcctcgggtgctgcgggggaggagccaagagaggcggaggaggaggaggagga
ggaggaggaggagctgcggagctgccctcggaggaccactgctcaccggggctgcggaga
agccaccggccccacgtctgcttccccgcgccgccgaccgccaccatgatcgccgcgcag
ctcctggcctattacttcaccgagctgaaggatgaccaagtcaaaaagattgataagtat
ctgtatgccatgcggctctctgatgaaactctgatagatattctgacccgcttcaagaag
gagatgaagaatggcctttccagggattataatccaacagcctcagtcaagatgttaccg
acctttgtaaggtccattcctgatggttcagaaaagggggatttcattgccctggatctt
ggcgggtcttcctttcgaatcctgagggtacaagtgaatcatgagaaaaaccagaatgtc
aacatggagtcggaggcctacgagaccccagagaacatcgtgcatggcagcggaagccag
ctttttgatcatgtcgctgagtgcctgggagacttcatggagaaaaggaagatcaaggac
aagaagttgcctgtggggttcacattttctttcccctgccgacaatccaaaatagatgag
gctgttctgatcacatggacaaagcggttcaaagccagcggtgtggaaggggccgatgtg
gtcaagctcctgaataaatccatcaagaagcgaggggactatgatgccaacattgtagct
gtggtaaatgatacagtggggaccatgatgacttgtggttatgatgaccagcagtgtgaa
gtgggcctgatcattggcactggcaccaacgcttgctatatggaggaactgagacatatt
gacctggtggaaggtgatgaggggaggatgtgcatcaacacagaatggggggccttcggg
gatgacggttccctggaagacatccgcactgagtttgacagagagttagaccggggatcc
ctcaaccctggaaaacagctgttcgagaagatggtcagtggcttgtacataggggagctg
gtccgcttgatcctggtcaagatggccaaagaaggtctcttatttgaagggcgcatcacc
ccagagctgctcaccagagggaagttcaataccagcgatgtgtcagccattgaacagaat
aaggaaggcatccaaaatgccagagaaatcttgacccgcctgggagtggagccctctgat
gatgactgtgtttcggtccagcacgtgtgcaccattgtctcctttcgctcagccaacctg
gtggctgccacgctgggtgccatcttgaaccgcctgcgtgacaacaaaggtacccccagg
ctgcggaccacggttggtgtggacggctctctctacaagacacacccccagtattcccga
cgtttccataagaccctgaggcgcctggtgcccgactgcgacgtgcgcttcctcctctcg
gagagtggcagtggcaagggtgctgccatggtgactgcagtggcctaccgcctggccgag
cagcaccggcagatcgaggagaccctggcccgcttccgcctcaccaagcagacactgctg
gaggtgaagaagaggatgcgtgttgagatggatttggggctgagtaagcagacccatgac
aaagctacagtcaagatgctgccttcttttgtccggagcattccagatgggactgagcac
ggcgactttttggccttggatcttggaggaacaaacttccgagtcctgctagtgaaaatc
cgaagcgggaaaaagagaacagtggagatgcacaataagatctattccattcccacggaa
atcatgcagggcaccggagaggagctgtttgaccacatcgtctcctgcatctccgacttc
ctggactacatggggatcaaaggcccccggatgcctctgggcttcaccttctcttttccc
tgcaaacagacaagcctggattgtggaatcctgatcacctggacaaagggtttcaaggcc
agtgactgcgtgggtcatgatgtagccactttgttaagggatgcgataaaaaggagagag
gaatttgacctggatgtggtggctatggtcaatgacactgtgggaaccatgatgacctgt
gcatatgaggaacccagctgtgaagttggacttattgtagggactggctccaatgcctgc
tacatggaggagatgaggaacgtggaggtgctggaagggaaccaggggcagatgtgcatc
aacatggagtggggcgcctttggggacaacgggtgtatggatgacatcagaacggagtat
gacagagtggtggatgaattctctctgaatgccgggaaacaaaggtatgaaaagatgatc
agtggtatgtacctgggggaaatcgtccgcaacatcttgattgacttcaccaagaaggga
ttcctcttccggggacagatctctgagcctctcaagactcggggcatctttgagaccaag
tttctctctcagattgagagtgaccgattagcgctgctccaagtgcgggccatcctccag
cagctgggtctgaacagcacgtgtgatgacagtatccttgtcaagaccgtatgcggggtg
gtgtccaagagggccgcacagctgtgtggcgcaggcatggctgccgtggtggaaaagatc
cgagagaacagagggctggaccatctgaatgtgactgtgggagtggatgggacactctac
aaacttcatccacacttctcaagaatcatgcaccaaaccgtgaaggaactgtcaccaaag
tgtagtgtgtccttcctcctgtctgaagatggcagtggcaagggggctgccctcatcaca
gctgtgggcgtgcggctcagaggagaaattacgagcagctaa

DBGET integrated database retrieval system