KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729786
Entry
103729786         CDS       T03372                                 

Gene name
Tcf7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04520  Adherens junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05132  Salmonella infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103729786 (Tcf7)
   04390 Hippo signaling pathway
    103729786 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103729786 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    103729786 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103729786 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103729786 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103729786 (Tcf7)
   05225 Hepatocellular carcinoma
    103729786 (Tcf7)
   05226 Gastric cancer
    103729786 (Tcf7)
   05216 Thyroid cancer
    103729786 (Tcf7)
   05221 Acute myeloid leukemia
    103729786 (Tcf7)
   05217 Basal cell carcinoma
    103729786 (Tcf7)
   05215 Prostate cancer
    103729786 (Tcf7)
   05213 Endometrial cancer
    103729786 (Tcf7)
   05224 Breast cancer
    103729786 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103729786 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103729786 (Tcf7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103729786 (Tcf7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103729786 (Tcf7)
   05165 Human papillomavirus infection
    103729786 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103729786 (Tcf7)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103729786 (Tcf7)
SSDB
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2
Other DBs
NCBI-GeneID: 103729786
NCBI-ProteinID: XP_017652254
LinkDB
Position
Un
AA seq 251 aa
MYKETVYSAFNLLMHYPPTSGAGQHPQPQPPLHKASQPPHGVPQLSPLYEHFSSQHPAPA
PADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPPTVSWFTHPSLMLGSGVPGHPAAIPHP
AIVPSSGKQELQPYDRGLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLK
ESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQ
ESTADNSLHYS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtacaaagagacggtctactctgccttcaatctgctgatgcactacccacccacctca
ggagcagggcagcatccccagcctcaacccccgctgcacaaggccagtcagcccccacac
ggtgtcccccaactctctcctctctacgaacatttcagcagtcaacaccccgcacctgca
cctgcggacatcagccagaagcaagttcacaggccactgcagactcctgacctctctgga
ttctactctctcacctcaggcagcatgggacagctcccccccactgtgagctggttcacc
cacccatccttgatgctgggatctggtgtacctggtcacccagctgccattcctcaccca
gccatcgtgccttcctcggggaagcaggagcttcagccctacgaccgtggcctgaaaaca
caggcagaatccaaggcagagaaggaggccaagaagccaaccatcaagaagcccctcaac
gctttcatgctttacatgaaggagatgagagccaaggtcatcgcagagtgcacactcaaa
gagagcgctgccatcaaccagatcctgggccgcaggtggcacgcgctgtctcgagaagag
caggccaagtactatgagctggctcgcaaagaaaggcagctgcacatgcagctgtaccca
ggctggtcggcacgggataactacggaaagaagaagaggcggtcaagggaaaagcatcag
gagtccaccgcagataactctcttcactattcctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731749
Entry
103731749         CDS       T03372                                 

Gene name
Tcf7l2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04520  Adherens junction
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05132  Salmonella infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103731749 (Tcf7l2)
   04390 Hippo signaling pathway
    103731749 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103731749 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103731749 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731749 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103731749 (Tcf7l2)
   05225 Hepatocellular carcinoma
    103731749 (Tcf7l2)
   05226 Gastric cancer
    103731749 (Tcf7l2)
   05216 Thyroid cancer
    103731749 (Tcf7l2)
   05221 Acute myeloid leukemia
    103731749 (Tcf7l2)
   05217 Basal cell carcinoma
    103731749 (Tcf7l2)
   05215 Prostate cancer
    103731749 (Tcf7l2)
   05213 Endometrial cancer
    103731749 (Tcf7l2)
   05224 Breast cancer
    103731749 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103731749 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103731749 (Tcf7l2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103731749 (Tcf7l2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103731749 (Tcf7l2)
   05165 Human papillomavirus infection
    103731749 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103731749 (Tcf7l2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103731749 (Tcf7l2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103731749
NCBI-ProteinID: XP_008828401
LinkDB
Position
Un
AA seq 626 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYPAYKTIEHQIAIQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPP
HMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLN
AFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYP
GWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNN
WCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPHLLGSPPQDAKSQTEQTQPLS
LSLKPEPLAHLSMMPPPPALLLAEAAHSKASALCPNGALDLPPATLQSPMVPSSSLAQPS
TSSLHSHNSLAGTQPQPLSLVTKSLE
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggagagcaggaggaaaagagctcggaaaactcgtcggccgagagggac
ttagctgatgtcaagtcgtctctggtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccacctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggataccccttcatcatgatccccgacctcaccagcccctacctccccaacggatcg
ctgtcgcccaccgccagaaccctccattttcagtccggcagcactcattaccctgcgtac
aaaacgattgaacaccagattgcaattcagtatcttcaaatgaaatggccactactcgat
gtccaggcaggaagcctccagagcagacaagccctcaaggatgctcggtcgccatctcca
gcacacattgtctcgaacaaagtgccggtggttcagcacccccaccatgtccacccactc
acgcctctcatcacctacagcaacgaacacttcaccccaggaaacccacctccacactta
ccagccgatgtagaccccaaaacaggaatcccacggcctccacatcctccagatatctct
ccatattatccactgtcgcctggcaccgtaggacaaatcccccatccgctaggatggtta
gtaccacagcaaggtcagcctgtgtaccctatcacgacaggaggattcagacacccctac
cccacagcactgaccgtcaacgcttctatgtctagctttctgtcttctaggttccctccc
cacatggtccctccccatcatactctccacacgaccggcatcccccatccggccattgtc
acaccaacagtcaagcaggaatcctcacagagtgatgtcggctcactccacagctcaaag
catcaggactccaaaaaggaggaagaaaagaagaaaccccacataaagaagcctcttaat
gcgttcatgttgtacatgaaggaaatgagagcgaaggttgtggctgagtgcacgttgaaa
gaaagcgcagccatcaaccagatcctcgggcgccggtggcacgcactgtccagagaagaa
caagcaaaatactatgagctggcccggaaggagcgacagcttcacatgcagctgtatcct
ggctggtccgcgcgggataactatgggaagaagaagaagaggaaaagggacaagcagcca
ggagagaccaatgaacacagcgaatgtttcctaaatccttgcctttcacttcctccgatt
acagacctgagcgctcctaagaaatgccgagcgcgctttggccttgatcaacagaataac
tggtgcggcccctgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagc
tgcctcagcccaccctcttcagatggaagcttactagactcgccgcccccctccccacac
ctgctaggctcccctccccaagacgccaagtcacagactgagcagacccagccactctca
ctgtccctgaagcctgaacccctggcccacctgtccatgatgccaccaccgcctgcgctc
ctgctggccgaggctgcccacagcaaggcctccgctctctgtcccaacggggctctggac
ctgccacctgccaccctgcagtcacccatggtcccctcctcatcgctcgcacagccgtca
acatcttccttacattcccacaattcgctggccgggacccagccccagcctctgtccctc
gtaaccaagtctttagaatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739783
Entry
103739783         CDS       T03372                                 

Gene name
Tcf7l1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04520  Adherens junction
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05132  Salmonella infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103739783 (Tcf7l1)
   04390 Hippo signaling pathway
    103739783 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103739783 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103739783 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739783 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103739783 (Tcf7l1)
   05225 Hepatocellular carcinoma
    103739783 (Tcf7l1)
   05226 Gastric cancer
    103739783 (Tcf7l1)
   05216 Thyroid cancer
    103739783 (Tcf7l1)
   05221 Acute myeloid leukemia
    103739783 (Tcf7l1)
   05217 Basal cell carcinoma
    103739783 (Tcf7l1)
   05215 Prostate cancer
    103739783 (Tcf7l1)
   05213 Endometrial cancer
    103739783 (Tcf7l1)
   05224 Breast cancer
    103739783 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103739783 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739783 (Tcf7l1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103739783 (Tcf7l1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739783 (Tcf7l1)
   05165 Human papillomavirus infection
    103739783 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103739783 (Tcf7l1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103739783 (Tcf7l1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 DUF1525
Other DBs
NCBI-GeneID: 103739783
NCBI-ProteinID: XP_008838473
LinkDB
Position
Un
AA seq 600 aa
MPQLGGGGGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSGDRVHW
MVPPTFRSNKVPVVQHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPS
ELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRF
SPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAAPSLSPAVSAKSPVTVKKEEEKKPHVKK
PLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQ
LYPTWSARDNYGKKKKRKREKQLSQAQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSP
ASSHGSTLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAT
ASNSSQMGSQPPLLSRPLPLGSMPTALLTSAPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgccccagctcggtggtggcggcgggggcggcgccggcgggggcggcggcggctccgga
gccggggcaaccagtggaggggacgacctcggggcgaacgacgaactgatccccttccag
gacgaggggggcgaggagcaggagccgagcagcgacagcgcatcggcacagcgggacctg
gatgaggtcaagtcgtccctggtcaacgagtcggagaatcagagcagcagctcagactca
gaggcggagaggcgcccgcagcctgcccgggacgctttccagaagccgcgggactatttc
gctgaagtgagaaggccccaggacggcgcgttctttaagggacctgcgtaccctgggtac
cccttcctgatgatcccagacctgagcagcccatacctctccaacggacccctgtctccg
ggtggagctcgcacctacctgcagatgaaatggccccttcttgacgttccctccagtgcc
acagtcaaggacacaaggtcaccatctccagcacacttgtccggggatcgtgtccactgg
atggtgcctcccacattcaggtccaacaaagttcctgttgttcagcaccctcatcacatg
cacccgttgacacccctcatcacctacagcaatgaccacttctcccctgcctctcctccc
acgcacctctccccagaaatcgatccaaagacaggaatcccccgcccccctcacccatct
gagctgtcaccatattacccactgtctcctggagctgttggacaaatcccccatcccctc
ggctggctcgtcccacagcaaggacaacccatgtactccctccctcctggtggcttccgg
catccttaccctgccctcgccatgaatgcctcaatgtccagcctggtgtccagtcggttc
tccccacacatggtggctcccgcacatcctggcctgcccacctcagggatcccccacccc
gccatcgtctcccccatcgtaaagcaggagccagcagcccccagcctgagtcctgcggtg
agcgcgaaatccccagtcaccgtgaagaaggaggaagaaaagaagcctcacgtgaagaag
cctctgaacgccttcatgttgtatatgaaggagatgagggccaaggtggtggctgagtgc
accctgaaggagagcgctgccattaaccaaatcctgggaagaaagtggcacaacctgtct
cgagaagaacaggccaagtactacgagctggcccggaaggagcggcagcttcattctcag
ctctacccaacctggtcagcccgggacaactacggtaagaaaaagaaaaggaagagagaa
aagcagctgtcacaggcacagtcccagcagcaaattcaagaggcagaaggtgctctggcc
tccaagagcaagaagccatgtattcagtacctgccccctgagaagccctgtgatagccct
gcctcttcccatggcagcacgctggactcacctgcgaccccctccgcagccttggcgtca
ccagctgcccctgctgccacccactccgagcaagcccagcccctgtccctcaccaccaaa
ccagagacccgggcccagctggctctccactcagctgccttcctgtcagcgaaggctaca
gccagcaactccagccagatgggcagccagcccccactcctgtccaggcccctgcccctg
gggtccatgcctacagctctgctgacctctgctccttccttcccagccacgctccatgcc
caccaggccctccctgtgctacaggcccagcctctttccttggtcaccaagtctgcccac
taa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103742515
Entry
103742515         CDS       T03372                                 

Gene name
Lef1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi04390  Hippo signaling pathway
ngi04520  Adherens junction
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05132  Salmonella infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05210  Colorectal cancer
ngi05213  Endometrial cancer
ngi05215  Prostate cancer
ngi05216  Thyroid cancer
ngi05217  Basal cell carcinoma
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103742515 (Lef1)
   04390 Hippo signaling pathway
    103742515 (Lef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103742515 (Lef1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103742515 (Lef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103742515 (Lef1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103742515 (Lef1)
   05225 Hepatocellular carcinoma
    103742515 (Lef1)
   05226 Gastric cancer
    103742515 (Lef1)
   05216 Thyroid cancer
    103742515 (Lef1)
   05221 Acute myeloid leukemia
    103742515 (Lef1)
   05217 Basal cell carcinoma
    103742515 (Lef1)
   05215 Prostate cancer
    103742515 (Lef1)
   05213 Endometrial cancer
    103742515 (Lef1)
   05224 Breast cancer
    103742515 (Lef1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103742515 (Lef1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103742515 (Lef1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103742515 (Lef1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103742515 (Lef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103742515 (Lef1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103742515 (Lef1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103742515
NCBI-ProteinID: XP_008841841
LinkDB
Position
Un
AA seq 412 aa
MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE
IIPASNGHEVVRQAPASQETYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNS
DPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQ
GMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQSVYPITGGFRQPYPSSLSGDTAMSRF
SHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKP
LNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQL
YPGWSARDNYGKKKKRKREKLQESTSGGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgccccagctctccggaggcggcggtgggggggacccggaactctgcgccaccgatgag
atgatccccttcaaggacgagggcgatccccaaaaggagaagatcttcgccgagatcagc
caccccgaagaggaaggcgacttggccgacatcaagtcatccttggtcaacgagtcggaa
atcattccggccagtaatggacacgaggtggtcagacaagcaccagcctctcaggagacc
tatcacgacaaggcccgagaacacccagacgatggaaagcatccagatggaggcttgtac
aacaagggaccctcctactccagttactctggctacatcatgatgcccaacatgaatagc
gacccgtacatgtcaaatggatccctttctccacccatcccaaggacatcaaataaagtg
ccagtggtgcagccgtcgcatgcggtccaccctctcacccccctcatcacttacagcgac
gagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactccaagcaa
ggcatgtccagacaccctccagctcctgaaatccccaccttttaccctctgtctccgggt
ggtgttggacagatcaccccacctcttggctggcaaggtcagtctgtatatcccatcacg
ggtggattcaggcaaccctacccatcctcactgtcaggcgacactgccatgtccaggttt
tctcatcacatgattcctggtcctcctgggccccacacaactggcatccctcacccagct
attgtaacgcctcaggtcaaacaggagcaccctcacactgacagtgacctaatgcacgtg
aagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaagaagcct
ctgaatgctttcatgttatacatgaaggaaatgagagcaaacgtcgtagcggagtgcact
ctgaaggagagtgcggccatcaaccagatcctgggcagacggtggcacgccctctctcgt
gaagaacaggctaaatattatgaattagcacggaaagaaagacagctacatatgcaactc
tatccaggctggtcggcgagagacaattatggtaagaagaagaagaggaagagagagaag
ctacaggaatctacttcaggtggaaaacgaagctcattcccaacgtgcaaagccaaggca
gcgaccccaggccctcttctagagatggaagcttgttga

DBGET integrated database retrieval system