KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730120
Entry
103730120         CDS       T03372                                 

Gene name
Adcy7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103730120 (Adcy7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103730120 (Adcy7)
   04371 Apelin signaling pathway
    103730120 (Adcy7)
   04020 Calcium signaling pathway
    103730120 (Adcy7)
   04072 Phospholipase D signaling pathway
    103730120 (Adcy7)
   04024 cAMP signaling pathway
    103730120 (Adcy7)
   04022 cGMP-PKG signaling pathway
    103730120 (Adcy7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103730120 (Adcy7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103730120 (Adcy7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103730120 (Adcy7)
   04062 Chemokine signaling pathway
    103730120 (Adcy7)
  09152 Endocrine system
   04911 Insulin secretion
    103730120 (Adcy7)
   04923 Regulation of lipolysis in adipocytes
    103730120 (Adcy7)
   04912 GnRH signaling pathway
    103730120 (Adcy7)
   04913 Ovarian steroidogenesis
    103730120 (Adcy7)
   04915 Estrogen signaling pathway
    103730120 (Adcy7)
   04914 Progesterone-mediated oocyte maturation
    103730120 (Adcy7)
   04921 Oxytocin signaling pathway
    103730120 (Adcy7)
   04926 Relaxin signaling pathway
    103730120 (Adcy7)
   04935 Growth hormone synthesis, secretion and action
    103730120 (Adcy7)
   04918 Thyroid hormone synthesis
    103730120 (Adcy7)
   04928 Parathyroid hormone synthesis, secretion and action
    103730120 (Adcy7)
   04916 Melanogenesis
    103730120 (Adcy7)
   04925 Aldosterone synthesis and secretion
    103730120 (Adcy7)
   04927 Cortisol synthesis and secretion
    103730120 (Adcy7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103730120 (Adcy7)
   04270 Vascular smooth muscle contraction
    103730120 (Adcy7)
  09154 Digestive system
   04970 Salivary secretion
    103730120 (Adcy7)
   04971 Gastric acid secretion
    103730120 (Adcy7)
   04972 Pancreatic secretion
    103730120 (Adcy7)
   04976 Bile secretion
    103730120 (Adcy7)
  09156 Nervous system
   04724 Glutamatergic synapse
    103730120 (Adcy7)
   04727 GABAergic synapse
    103730120 (Adcy7)
   04725 Cholinergic synapse
    103730120 (Adcy7)
   04723 Retrograde endocannabinoid signaling
    103730120 (Adcy7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103730120 (Adcy7)
  09149 Aging
   04211 Longevity regulating pathway
    103730120 (Adcy7)
   04213 Longevity regulating pathway - multiple species
    103730120 (Adcy7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103730120 (Adcy7)
   04714 Thermogenesis
    103730120 (Adcy7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730120 (Adcy7)
  09165 Substance dependence
   05032 Morphine addiction
    103730120 (Adcy7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103730120 (Adcy7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103730120 (Adcy7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103730120 (Adcy7)
   05163 Human cytomegalovirus infection
    103730120 (Adcy7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103730120 (Adcy7)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103730120 (Adcy7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 103730120
NCBI-ProteinID: XP_017652446
LinkDB
Position
Un
AA seq 1081 aa
MPTKGRYFLNEGEEGADQAALYEKYRLSSQHGPLLLLLLLVAVAACIALISISFSHGDPS
RHQAILGTSFFMLTLFVVLYVLVYVECLVRRWLQALALLTWVCLMMLGSMLVWDSWKKEA
CAWEQVPFFLFIVFVVYALLPLSTRAAVTVGLVSTISHLLVFGAVTGAFRMSLTGTQLWL
QLLANAVILLGGNFTGAFHKHQLQDASRDLFTYTVKCIQIRRKLRVEKRQQENLLLSVLP
AHISMGMKLAIIERLKESGDRSYMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDICEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLNHLDKAYEVEDGHGQQRDPYLKEMNVRTYLVIDPRSQQPPQPSHHLPKPKGDAALKM
RASVRVTRYLESWGAARPFAHLNHRESVSSSETPIPNGRKPKAIPLRRHRTPDRSASPKG
RLEDDCDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARYDFAC
ASLVFICILLVHVLVMSRVTTLGVSFGLVACLLGMVLGLCFATEFSRCCPARGMLWVISE
SVETQPLLRLSLVVLTVGSLLTVAIINMPLMLNSDLELPGGNEASLLATRNRVRTLCEFI
PHYTCSCILGFIACSVFLRMSLELKVVLLTVALVAYLLLFNLSPCWQLDCCGHSPGNITE
TNSTLSSTLECSQKDLKTMINFYLVLFYATLVMLSRQIDYYCRLDYLWKKKFKKEHEEFE
TMENVNRLLLENVLPAHVAAHFIGDKAAEDWYHQSYDCVCVMFASVPDFKVFYTECDVNK
EGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVPSGHENQDQERQHV
HIGVLVEFSMALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVA
SRMESTGELGKIQVTEETCIILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKVQGLGL
N
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgccgaccaaaggacgctacttcctcaatgagggcgaggagggcgcggaccaggcagca
ctctatgagaagtaccgcctcagcagccagcatgggccactgctgctcttgctcctcctg
gtggctgtggctgcctgcattgcactcatcagcatctcattcagccatggggatccctcc
agacaccaggccattctgggtacttcattcttcatgctgacgctgtttgtggttctctat
gtgctggtgtatgttgagtgcctggttcggcgatggctgcaggccttggctctgctcacc
tgggtctgcctcatgatgctgggctccatgctggtgtgggactcctggaagaaagaggcc
tgtgcgtgggagcaggtgcccttcttcctgttcatcgtattcgtggtgtatgcactgctg
cccctcagcacgcgagctgctgtcacagtggggttagtctccactatctcccacctcctg
gtgtttggcgctgtgacaggagccttcaggatgtccctgactggcacacagctgtggctg
cagctgctggccaatgctgtcatcctcctgggtgggaacttcactggtgccttccacaag
caccagcttcaggatgcctcccgagacctcttcacctacaccgtcaagtgcatccagatc
cggaggaagctgcgtgtggagaagcgccaacaggagaacctgctgctttcagtgctccca
gcacacatctccatgggcatgaagctggccatcattgagcggctcaaagagagtggggac
cgcagctacatgcctgataacaactttcacagcctttatgtcaagcggcaccagaatgtc
agcatcttgtatgcagacatcgtgggcttcacgcagctggccagtgactgctctccaaag
gagttggtggtggtgctcaatgagctcttcgggaagttcgaccaaattgccaaggccaat
gagtgcatgcggatcaagatcctgggcgactgctactactgcgtttcaggccttcctgtg
tcgctgcccacccatgcccgcaactgtgtgaagatggggctggatatttgtgaggctatt
aagcaggtgcgagaggccacaggtgtcgacatcagcatgcgtgtgggcatccactcgggg
aacgtgctgtgtggggtcatcggactccgaaagtggcagtatgatgtgtggtctcatgat
gtgtccttggctaacaggatggaggcggctggagtgcctggccgggtgcacatcactgaa
gcgacactaaaccacctggacaaggcatacgaggtggaggatgggcacgggcagcagaga
gacccttacctgaaagagatgaacgtccgaacctacctggtgatcgacccccggagccag
cagccgcctcaacctagtcaccacctccccaagcccaagggggatgcggccctgaagatg
cgggcttcggtgcgtgtgacccgctacctggagtcctggggggccgcacggcccttcgca
cacctcaaccaccgggagagtgtgagcagcagtgagacccccatccccaatggacggaag
cccaaggccattcctctgcgccgacaccgtacccctgacaggagtgcatctcccaagggg
cgcttagaggatgactgtgatgatgagatgctttcagccattgaggggctcagctctacc
aggccttgctgctccaagtctgatgacttctacacctttggttccatcttcctggagaaa
ggctttgagcgtgagtatcgcctggcacccatcccccgggcccgctacgacttcgcttgt
gccagccttgtgttcatctgcattctgcttgtccacgtgctagtgatgtccagggtgacg
actctgggtgtgtcctttggactggtggcctgcctgctggggatggtgctaggtctgtgc
tttgccactgagttctcaaggtgctgtccagcccgggggatgctctgggttatctcagaa
agcgtggagacacagcctctgctgaggctgtctctggttgtgctgaccgtgggcagccta
ctgactgttgccatcatcaacatgccattgatgcttaactcagacctggagctgcctggt
ggcaatgaggcaagcctgctagctacaaggaacagagtcaggaccttgtgtgagttcatt
ccgcactatacctgcagctgcatcctgggcttcattgcttgctcggtctttctgcggatg
agcctagagctgaaggttgtgctgctgacagtggccctggtggcctatctgctgcttttc
aacctttccccgtgctggcagttggactgctgtggccacagcccaggcaacatcactgaa
accaacagcactctcagcagcaccctggaatgttcacagaaggacctgaagaccatgatc
aacttctacctggtcctgttctacgccaccctcgtcatgctgtctagacagattgactat
tactgccgcttggactatctgtggaagaagaagttcaagaaggagcacgaggaatttgag
accatggagaatgtgaaccgcctgctcctggagaatgtgctgccagcccacgtggctgcc
cacttcatcggtgacaaggcagctgaggactggtaccatcagtcctatgactgtgtctgt
gtcatgtttgcatccgttcccgacttcaaagtgttctacacggaatgcgatgtcaacaaa
gaagggctagagtgccttcgcctgctgaacgagatcatcgccgactttgatgagctgctg
ctgaagcccaagttcagtggcgtggagaagatcaagaccattggcagcacctacatggct
gcagcggggctcagtgtcccctcagggcacgagaaccaggaccaggagcggcagcatgtg
cacattggtgtattggtggagttcagcatggccctgatgagcaagctggatggaatcaac
aggcattccttcaactccttccgtctccgagttggcataaaccacgggcctgtgattgct
ggagtgattggagcacgcaagcctcagtatgacatctggggaaacacagtcaatgttgcc
agccgcatggaaagcactggagaacttgggaaaatacaggttacagaagagacgtgcata
atcctccagggactgggttattcttgtgagtgccgggggctgatcaacgttaaaggcaaa
ggcgagctgaggacttactttgtgtgtacagacactgccaaggttcaaggactggggctg
aactaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735350
Entry
103735350         CDS       T03372                                 

Gene name
Adcy2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103735350 (Adcy2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103735350 (Adcy2)
   04371 Apelin signaling pathway
    103735350 (Adcy2)
   04020 Calcium signaling pathway
    103735350 (Adcy2)
   04072 Phospholipase D signaling pathway
    103735350 (Adcy2)
   04024 cAMP signaling pathway
    103735350 (Adcy2)
   04022 cGMP-PKG signaling pathway
    103735350 (Adcy2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103735350 (Adcy2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103735350 (Adcy2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103735350 (Adcy2)
   04062 Chemokine signaling pathway
    103735350 (Adcy2)
  09152 Endocrine system
   04911 Insulin secretion
    103735350 (Adcy2)
   04922 Glucagon signaling pathway
    103735350 (Adcy2)
   04923 Regulation of lipolysis in adipocytes
    103735350 (Adcy2)
   04912 GnRH signaling pathway
    103735350 (Adcy2)
   04913 Ovarian steroidogenesis
    103735350 (Adcy2)
   04915 Estrogen signaling pathway
    103735350 (Adcy2)
   04914 Progesterone-mediated oocyte maturation
    103735350 (Adcy2)
   04921 Oxytocin signaling pathway
    103735350 (Adcy2)
   04926 Relaxin signaling pathway
    103735350 (Adcy2)
   04935 Growth hormone synthesis, secretion and action
    103735350 (Adcy2)
   04918 Thyroid hormone synthesis
    103735350 (Adcy2)
   04928 Parathyroid hormone synthesis, secretion and action
    103735350 (Adcy2)
   04916 Melanogenesis
    103735350 (Adcy2)
   04925 Aldosterone synthesis and secretion
    103735350 (Adcy2)
   04927 Cortisol synthesis and secretion
    103735350 (Adcy2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103735350 (Adcy2)
   04270 Vascular smooth muscle contraction
    103735350 (Adcy2)
  09154 Digestive system
   04970 Salivary secretion
    103735350 (Adcy2)
   04971 Gastric acid secretion
    103735350 (Adcy2)
   04972 Pancreatic secretion
    103735350 (Adcy2)
   04976 Bile secretion
    103735350 (Adcy2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103735350 (Adcy2)
   04727 GABAergic synapse
    103735350 (Adcy2)
   04725 Cholinergic synapse
    103735350 (Adcy2)
   04723 Retrograde endocannabinoid signaling
    103735350 (Adcy2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103735350 (Adcy2)
  09149 Aging
   04211 Longevity regulating pathway
    103735350 (Adcy2)
   04213 Longevity regulating pathway - multiple species
    103735350 (Adcy2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103735350 (Adcy2)
   04714 Thermogenesis
    103735350 (Adcy2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735350 (Adcy2)
  09165 Substance dependence
   05032 Morphine addiction
    103735350 (Adcy2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103735350 (Adcy2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103735350 (Adcy2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103735350 (Adcy2)
   05163 Human cytomegalovirus infection
    103735350 (Adcy2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103735350 (Adcy2)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103735350 (Adcy2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 103735350
NCBI-ProteinID: XP_008832799
LinkDB
Position
Un
AA seq 1037 aa
MGACLALLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIW
ICLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLS
ICLSATPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCLKSRIKLE
FEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYA
DIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNH
AKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLAN
HMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQ
HLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTMDVPMGQHN
FQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKIIEKEYRA
TALPAFKYYVTCACLIFLCIFIVQVLVLPKTSILGISFGAAFLSLAFILFVCFAGQLLQC
SKKASASLMWLLKSSGIIANRPWPRISLTIVTTTIILTMAVFNMFFLSDPEETILPAANS
SSANSSTPDNQTAILRAQKLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYN
IILLHTHAHVLDAYSQVLFERPGIWKDLKTMGPVSLSVFFITLLVLGRQNEYYCRLDFLW
KNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIP
DFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAV
PSQEHTQEPERQYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQ
KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGNLTTY
FVNTEMSRSLSQSNVAS
NT seq 3114 nt   +upstreamnt  +downstreamnt
atgggcgcctgcctcgccctgctcgccgtcttcttcgcgctcgggctggaagtggaagac
catgtggcatttttaataacagttcccactgccctggcaattttttttgccatattcatc
ctggtctgcatcgagtctgtgttcaagaagctgctccgtgttttctcactggtgatctgg
atatgtctggttgccatgggatacctgttcatgtgcttcggaggcaccgtctctccctgg
gaccaggtgtccttcttcctcttcatcatcttcgtggtatacaccatgctgcccttcaac
atgcgagatgccatcatcgccagcgtcctcacctcttcatcccacaccatcgtgctgagc
atctgtctgtctgcaacgccgggagccaaggagcacctggtctggcagattctggccaac
gtgatcattttcatctgtggtaacttggcaggcgcctaccataagcacctcatggaactg
gctctgcagcaaacctatcaggacacctgtaactgcctcaagtcccggatcaagcttgaa
tttgaaaaacgtcagcaggagcggctgctgctctccttgctgccggctcacattgccatg
gagatgaaggcagagatcatccaaaggctacaaggccccaaagcaggccagatggaaaac
acaaataactttcacaacctgtatgtcaagaggcacaccaacgtgagcatcttatatgct
gacattgttggattcactcgtctcgcaagtgactgctccccaggggaactggtccacatg
ctgaatgaactctttgggaagtttgatcagattgcaaaggagaatgaatgcatgagaatt
aaaattttaggagactgctattactgtgtttccggactccctatatctcttcctaaccat
gccaagaactgtgtgaaaatgggcttggatatgtgtgaagctataaagaaggtgagggat
gctacgggcgttgacatcaacatgcgtgtaggagtgcactctgggaacgtcctctgtggt
gtgatcggtctccaaaagtggcagtatgacgtctggtcacatgacgttacattggccaac
catatggaggctggaggagtccctggacgtgttcacatttcttcagtcaccctggaacat
ttgaatggagcttataaagtagaagaaggagatggtgaaataagagacccgtatttaaag
cagcacttagtgaaaacctactttgtaatcaaccccaagggagagcgacggagtccccag
cacctcttcagacctcgccataccctggatggagccaagatgagggcttctgtccgcatg
acccggtacttggagtcctggggagcggccaagcccttcgcacacctgcaccacagagac
agcatgaccacagaaaatgggaagatcagcaccatggatgtgccgatgggtcaacataat
tttcaaaatcgcaccttaagaactaagtcacaaaagaaaagatttgaagaagaattgaat
gaaaggatgatccaagcaattgatggaatcaatgcacaaaagcaatggctcaagtctgag
gacattcaaagaatctctctgcttttctataacaagattatagagaaagaataccgagcc
acggcgctgccagcgttcaagtactacgtgacgtgcgcctgcctcatcttcctctgcatc
ttcatcgtgcaggttcttgtgctgccaaaaacatcgatcctcggcatctcctttggagct
gcatttctctcgcttgccttcatcctctttgtctgctttgctgggcagcttttgcaatgc
agcaaaaaggcctcagcctctctcatgtggcttttgaagtcatccggcatcatcgccaac
cgcccgtggccgcggatctcgctcacaattgtcaccacgacgatcattctgaccatggct
gtgttcaacatgtttttcctgagtgacccagaggagaccatccttccagctgccaattcc
tcaagtgcaaactcttccaccccagacaaccagacagcgattcttcgtgcacagaagtta
tttttcctcccgtacttcatatacagctgcattctgggactaatctcctgctcggttttc
ctgagggtgaattatgagctgaagatgttgatcatgatggtggcgctagtgggttataac
atcatcctgctccacacccacgctcacgtcctggacgcctacagccaggtcctgtttgag
agaccaggcatttggaaagacctgaagaccatgggccccgtgtccctttctgtgttcttc
atcacgctgctcgtactgggtagacagaatgaatattactgtaggttagacttcttgtgg
aagaacaagttcaaaaaagagcgggaggagatagaaaccatggagaacctgaaccgcgtg
ctgctggagaacgtgcttcctgcacatgtggctgagcacttcctggccaggagcctgaag
aatgaggagctgtaccaccagtcctacgactgtgtctgcgtcatgttcgcctctattcct
gatttcaaggaattctacacagaatcagatgtgaacaaggaaggcttggaatgccttcgg
ctcctgaatgagatcatcgctgactttgatgatctgctctccaagccgaagttcagtggt
gttgaaaagatcaagaccatcggtagcacgtacatggcagccacgggtcttagtgccgta
cccagccaggagcacacccaggagcctgaacgtcagtacatgcacataggaaccatggtg
gagtttgcatttgccctggtggccaaattggatgccatcaataagcactccttcaatgac
ttcaaactgcgcgtgggtatcaaccatggacctgtaatcgctggtgtcataggagcgcag
aagccacaatatgacatctggggcaacactgtcaacgtggcaagcaggatggacagcacc
ggggtcctggacaaaatacaggttaccgaagagacaagcctcatcctccagacgcttggc
tacacatgcacatgtcgaggcataatcaatgtgaaaggaaaggggaacctgacgacgtac
tttgtaaacacagagatgtcacggtccctctcccagagcaacgtggcatcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739411
Entry
103739411         CDS       T03372                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103739411 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103739411 (Adcy4)
   04371 Apelin signaling pathway
    103739411 (Adcy4)
   04020 Calcium signaling pathway
    103739411 (Adcy4)
   04072 Phospholipase D signaling pathway
    103739411 (Adcy4)
   04024 cAMP signaling pathway
    103739411 (Adcy4)
   04022 cGMP-PKG signaling pathway
    103739411 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103739411 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103739411 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103739411 (Adcy4)
   04062 Chemokine signaling pathway
    103739411 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    103739411 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    103739411 (Adcy4)
   04912 GnRH signaling pathway
    103739411 (Adcy4)
   04913 Ovarian steroidogenesis
    103739411 (Adcy4)
   04915 Estrogen signaling pathway
    103739411 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    103739411 (Adcy4)
   04921 Oxytocin signaling pathway
    103739411 (Adcy4)
   04926 Relaxin signaling pathway
    103739411 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    103739411 (Adcy4)
   04918 Thyroid hormone synthesis
    103739411 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    103739411 (Adcy4)
   04916 Melanogenesis
    103739411 (Adcy4)
   04925 Aldosterone synthesis and secretion
    103739411 (Adcy4)
   04927 Cortisol synthesis and secretion
    103739411 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103739411 (Adcy4)
   04270 Vascular smooth muscle contraction
    103739411 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    103739411 (Adcy4)
   04971 Gastric acid secretion
    103739411 (Adcy4)
   04972 Pancreatic secretion
    103739411 (Adcy4)
   04976 Bile secretion
    103739411 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103739411 (Adcy4)
   04727 GABAergic synapse
    103739411 (Adcy4)
   04725 Cholinergic synapse
    103739411 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    103739411 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    103739411 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    103739411 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    103739411 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    103739411 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103739411 (Adcy4)
   04714 Thermogenesis
    103739411 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103739411 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    103739411 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103739411 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103739411 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103739411 (Adcy4)
   05163 Human cytomegalovirus infection
    103739411 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103739411 (Adcy4)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103739411 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103739411
NCBI-ProteinID: XP_008838013
LinkDB
Position
Un
AA seq 1068 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALPAVAWASGRELTSDTS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLIWAALLALGHGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGLTSSLSHLLVLGLYLGWQPDSQPALLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQAGQGSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
VYAVEDVAMEHRDPYLRELGEPTYLVIDPRAKEEDEKGTAGGLLSSLEGHKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLPEAFSPQWSLDRSRTPRGLDDELDTGDAKFFQV
IEQLNSQKQWKQSKDFNLLTLYFREKEMEKQYRLSALPAFKYYAACTFLVFLSNFTIQML
VTNRPPALAITYSITFLLFLLLLIVCFSEHLMKCVRKGPKMLHWLPALSGLVATRPGLRV
ALGTATILLVFTMATASLLFLPVSSDCLFLVSNVSSMAFNHSWELPGSLPLISIPYSMHC
CVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLIACLYQGPLNSRPGV
LKEPKLMGAMSFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLEN
VLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNE
IIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDAERSCSHLGTMVEFAV
ALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLG
KIQVTEETARALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPP
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggcccgtctcttcagcccccggcctccccccagcgaagacctcttctatgagacctac
tacagcctgagccaacagtacccgctgttgctactgcttctggtgatcgtgctgtgcgcg
ctcctggcactgcccgccgtcgcctgggccagcggcagggagctgacctcagacacaagc
ttcctgaccactgtgctgtgcgctttgggtggcttctcgctgttgttggggctagcttct
agagagcaaagactgcagcgctggacacgacctctctctggcctaatatgggctgcactg
ctggccctaggccatggcttcctgttcacggggggcgtagtaagtgcctgggaccaggtg
tcatttttcctcttcatcatctttactgtgtacgccatgttgcccttgggcatgcgggat
gctgccgcagcaggcctcacctcgtcactctcacacctgcttgtccttgggctgtacctc
ggatggcagcccgattcacagcccgcactgctaccacagctggcagcaaatgcagtgttg
ttcctgtgtgggaatgtggtgggagcgtaccacaaggccctgatggaacgagctttgcgt
gccacattccgggaagcactcagctccctgcactcacgccggaggctggacacagagaaa
aagcaccaggagcaccttctcttgtccatccttcctgcctacctggcccaagagatgaaa
gcagagatcatggcacggctgcaggctggacagggctcacgaccggagaacacaaacaat
ttccacagcctatatgtcaagaggcaccaaggagttagtgtgctgtacgctgacattgtg
ggcttcacacggctagccagcgagtgctcccctaaggagctggtactcatgctcaacgag
ctcttcggcaagtttgaccagattgccaaggagcacgaatgcatgcggatcaagatccta
ggggactgttactactgtgtctccgggctgccactctcgctgccagaccatgccatcaac
tgtgtacgcatgggactggacatgtgccgggccatcaggaaacttcgggcagccactggt
gtagacatcaacatgcgtgtgggtgtgcattcaggcagtgtgctctgtggagtcatcggg
ctacagaagtggcagtatgatgtctggtctcatgacgtcacattggccaaccacatggag
gcaggtggtgtaccagggcgagtgcatatcacaggcgctaccctggccttgctggcagga
gtttatgctgtggaggacgtagccatggaacaccgagacccataccttcgggagctaggc
gagcctacatacctggtcattgatcctcgggccaaagaggaagatgagaagggcacagca
ggagggttactgtcctctttggagggccacaagatgcgcccatcactactgatgacccgt
tacctagagtcttggggtgcagccaaacctttcgcccacctgagccacgttgacagtcct
gtatccacttccactccgctcccggaggccttcagcccccagtggagcctggaccggagc
cgcacccctcggggactagacgatgagctggatactggggatgccaagttcttccaggtc
atcgagcaactcaactctcagaaacaatggaagcagtcaaaggacttcaacctactgaca
ctgtacttcagagagaaggagatggagaaacagtatcggctctctgcactccctgccttc
aagtactatgcagcctgcaccttcctggtttttctgtccaacttcactatccaaatgctg
gtgacaaacaggcccccagctctggccatcacctacagcatcacgttcctcctcttcctt
ctcctcctcatcgtctgcttctcagagcacctgatgaagtgtgtgcggaaaggtcccaag
atgctacactggctgcctgcactgtctggcctggtggccacaaggccaggacttcgagtg
gccctgggcactgccaccatcctcctggtcttcaccatggccactgccagcctgctcttc
ctaccggtgtcatcagactgcctcttcctggtttccaatgtttcttccatggctttcaat
cactcctgggagcttcctggatccctgcctctcatcagcatcccatactccatgcactgt
tgtgtgctgggtttcctctcctgctccctctttctgcacatgagcttcgaactgaagctg
ttgctgctcctgctgtggctggcagcatcttgttccctcttcctgcactcccacgcctgg
ctgtctgattgcctcatcgcctgcctttatcaaggccctttgaactccaggccaggagtg
ctgaaggagcccaaactgatgggagcgatgtcctttttcatcttcttcttcaccctcctt
gtcctggctcggcagaatgagtattactgccgcttggacttcctgtggaagaagaaactg
aggcaggagcgtgaggagacagagacgatggagaacttgacccggctactcctggagaat
gtgctccctgcccacgtggccccccagttcattggccagaaccggcgcaacgaggacctt
taccaccagtcgtacgaatgtgtttgtgtgctctttgcatcagtcccagactttaaggaa
ttctactcagaatccaacatcaaccacgagggactagagtgtctgaggctgcttaatgag
atcattgctgattttgatgagctgctctccaagccaaaattcagtggggtggagaagatc
aaaactattggcagtacctacatggcagccacaggcttaaatgccacatctggacaggac
acacaacaggatgctgaaagaagttgcagccatctgggcaccatggtggaatttgcagtg
gccctggggtctaaactggatgtcatcaacaagcactcattcaacaacttccgcctgcgt
gtagggttgaaccatggaccagtagtggctggagtgattggggcccagaagccacaatat
gacatctggggcaacacagtgaatgtagccagccgcatggagagtacaggagtccttggc
aagatccaagtgactgaggagacagccagggccctgcagtccctgggttatacatgctac
agccggggtatcatcaaggtcaaaggcaaagggcagctctgcacctacttcttgaacaca
gacttgacacgaactggacctccctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741433
Entry
103741433         CDS       T03372                                 

Gene name
Adcy1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103741433 (Adcy1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103741433 (Adcy1)
   04371 Apelin signaling pathway
    103741433 (Adcy1)
   04020 Calcium signaling pathway
    103741433 (Adcy1)
   04072 Phospholipase D signaling pathway
    103741433 (Adcy1)
   04024 cAMP signaling pathway
    103741433 (Adcy1)
   04022 cGMP-PKG signaling pathway
    103741433 (Adcy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103741433 (Adcy1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103741433 (Adcy1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103741433 (Adcy1)
   04062 Chemokine signaling pathway
    103741433 (Adcy1)
  09152 Endocrine system
   04911 Insulin secretion
    103741433 (Adcy1)
   04923 Regulation of lipolysis in adipocytes
    103741433 (Adcy1)
   04912 GnRH signaling pathway
    103741433 (Adcy1)
   04913 Ovarian steroidogenesis
    103741433 (Adcy1)
   04915 Estrogen signaling pathway
    103741433 (Adcy1)
   04914 Progesterone-mediated oocyte maturation
    103741433 (Adcy1)
   04921 Oxytocin signaling pathway
    103741433 (Adcy1)
   04926 Relaxin signaling pathway
    103741433 (Adcy1)
   04935 Growth hormone synthesis, secretion and action
    103741433 (Adcy1)
   04918 Thyroid hormone synthesis
    103741433 (Adcy1)
   04928 Parathyroid hormone synthesis, secretion and action
    103741433 (Adcy1)
   04916 Melanogenesis
    103741433 (Adcy1)
   04925 Aldosterone synthesis and secretion
    103741433 (Adcy1)
   04927 Cortisol synthesis and secretion
    103741433 (Adcy1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103741433 (Adcy1)
   04270 Vascular smooth muscle contraction
    103741433 (Adcy1)
  09154 Digestive system
   04970 Salivary secretion
    103741433 (Adcy1)
   04971 Gastric acid secretion
    103741433 (Adcy1)
   04972 Pancreatic secretion
    103741433 (Adcy1)
   04976 Bile secretion
    103741433 (Adcy1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103741433 (Adcy1)
   04727 GABAergic synapse
    103741433 (Adcy1)
   04725 Cholinergic synapse
    103741433 (Adcy1)
   04720 Long-term potentiation
    103741433 (Adcy1)
   04723 Retrograde endocannabinoid signaling
    103741433 (Adcy1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103741433 (Adcy1)
  09149 Aging
   04211 Longevity regulating pathway
    103741433 (Adcy1)
   04213 Longevity regulating pathway - multiple species
    103741433 (Adcy1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103741433 (Adcy1)
   04714 Thermogenesis
    103741433 (Adcy1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741433 (Adcy1)
  09165 Substance dependence
   05032 Morphine addiction
    103741433 (Adcy1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103741433 (Adcy1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103741433 (Adcy1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103741433 (Adcy1)
   05163 Human cytomegalovirus infection
    103741433 (Adcy1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103741433 (Adcy1)
   05142 Chagas disease
    103741433 (Adcy1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103741433 (Adcy1)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103741433 (Adcy1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 103741433
NCBI-ProteinID: XP_008840410
LinkDB
Position
Un
AA seq 894 aa
MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSF
LKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQPELEMADL
NFFTLKYKHVEREQKYHQLQDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFSI
CFLVACVLYLHITRVQCFPGCLTIQIRTILCIFIVVLIYSVAQGCVVGCLPWAWSSQSNS
SLVVLAAGGRRTVLPALPCESAHHALLCCLVGTLPLAIFLRVSSLPKMILLSGLTTSYIL
ILELSGYTKAGGGALSGRSYEPIMAILLFSCTLALHARQVDVRLRLDYLWAAQAEEERDD
MERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELD
GNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGARARKSIS
SHLSTLADFAIDMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNV
ASRMDSTGVQGRIQVTEEVHRLLRRCSYQFVCRGKVSVKGKGEMLTYFLEGRTDGNSTHS
RSLRLERRMCPYGRGGGQARRPPLCPAAGPPIRRGLPPAPTGQYLPSTAAGKEA
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgtatggtgtcttcgtgcggatcctgactgagcgctcacagaggaaggccttcttgcag
gctcgaagctgcattgaggaccggctgcggctggaggatgagaacgagaagcaggagcgg
ctgctcatgagcctcttgccccggaatgttgccatggagatgaaggaagacttcttgaag
ccccctgagaggattttccacaagatttacatccagagacatgacaacgtgagcatcctg
tttgcagatatcgtgggcttcacaggtctggcatcccagtgcacagctcaggagctggtg
aaactgctcaacgagctctttggcaagttcgatgagttagctacggagaaccactgtcgc
cgcatcaagatccttggagactgctactactgcgtatctggcctcacccagcccaaggcc
gaccatgctcactgctgcgtggagatgggccttgacatgattgataccatcacatctgtg
gctgaggctaccgaggtagacctgaacatgcgtgtgggtctgcacaccggcagggtcctc
tgcggagtcctgggcctgcgcaagtggcagtacgatgtgtggtccaatgacgtgactctg
gccaacgtcatggaagctgctggactgccagggaaggttcacatcacaaagacgacactt
gcatgtttgaatggtgactacgaggtcgagccaggtcacggacatgagagaaacagcttc
ctgaaaactcacaacatcgagaccttctttattgtgccatcccatcggaggaagatattt
ccaggcttgattctctcagatataaagccagccaagaggatgaagttcaagactgtctgc
tacctgctggtgcagctcatgcactgccggaagatgttcaaggctgagatccccttctct
aatgtgatgacctgcgaggatgatgacaagcggagagcattgagaacagcctcagaaaaa
ctcagaaaccgctcgtctttttctacaaacgtggtctacaccactccaggcacacgtgtc
aacaggtatatcagccgccttcttgaagcccgccagccagagctggagatggctgatctg
aacttctttaccctgaagtacaaacatgttgaacgggagcaaaaataccaccagcttcag
gatgagtacttcaccagtgctgtcgtcctcgccctcatcctggctgccttatttgggctt
gtctaccttctgataatcccacagagtgtggctgtcctgctcctgctggtgttctctatc
tgctttctggtggcctgtgtcctgtacctgcacatcacacgggtccagtgtttcccaggg
tgcctgacgatccagatccgcaccatcttgtgcatattcatagtggtcttaatctactca
gtagctcaaggatgtgtggtgggctgcctgccctgggcctggagctctcagtccaacagt
tccctggtggtccttgcggctggtggccggcgcactgtgctgcctgccctgccctgtgag
tctgcacaccatgccctgctctgctgcctggtgggcaccctcccactagccatattcctg
cgggtgtcctccttgccaaagatgatcctgctgtctgggctgaccacatcctacatcctc
atcctggagctcagtggttacaccaaggctgggggtggtgccctctctgggcgcagttat
gagccaatcatggctatcctgctgttctcatgcacactggccctgcacgccaggcaagtg
gatgtcagactgcggctggactacctctgggcagcacaggcagaagaggagcgtgatgac
atggagagggtgaagctggacaacaagaggatcctcttcaacctcctgccagcccatgtg
gcacagcacttcctcatgtccaatcccaggaacatggacctctactatcagtcctactcc
caggtgggtgtcatgtttgcctccattcccaacttcaatgacttctacattgagcttgat
ggcaacaacatgggagtagaatgtctgcggctcctcaacgagatcattgctgacttcgat
gagctcatggacaaggacttttacaaggacctagagaagatcaagaccatcgggagcacc
tacatggctgcagtggggctggcgcccacagcaggagccagggcgaggaagtccatctct
tcccacctgagcacactggctgactttgccattgacatgtttgatgtcctggatgaaatc
aactaccaatcatacaacgactttgttctccgagttggcatcaacgttggccctgtggtg
gctggagtgattggcgctcgaagaccccaatatgacatctggggaaatacagtcaatgtg
gccagtcggatggacagcactggggtccagggcagaatccaggtgactgaggaggtccac
cggctgctgaggaggtgctcttaccagtttgtatgccgaggcaaagtcagcgtcaagggc
aagggagagatgctaacatactttctagaaggcaggactgatggaaacagcacccacagc
aggtctcttcgcttggagcggaggatgtgtccatatgggagaggaggaggccaggccagg
cggcccccattatgtcctgcagctggacccccgatcagacgtgggctccccccagccccc
acaggccagtatctaccatccacagcagcagggaaagaagcctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741989
Entry
103741989         CDS       T03372                                 

Gene name
Adcy5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05012  Parkinson disease
ngi05030  Cocaine addiction
ngi05031  Amphetamine addiction
ngi05032  Morphine addiction
ngi05034  Alcoholism
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103741989 (Adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103741989 (Adcy5)
   04371 Apelin signaling pathway
    103741989 (Adcy5)
   04072 Phospholipase D signaling pathway
    103741989 (Adcy5)
   04024 cAMP signaling pathway
    103741989 (Adcy5)
   04022 cGMP-PKG signaling pathway
    103741989 (Adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103741989 (Adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103741989 (Adcy5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103741989 (Adcy5)
   04062 Chemokine signaling pathway
    103741989 (Adcy5)
  09152 Endocrine system
   04911 Insulin secretion
    103741989 (Adcy5)
   04923 Regulation of lipolysis in adipocytes
    103741989 (Adcy5)
   04912 GnRH signaling pathway
    103741989 (Adcy5)
   04913 Ovarian steroidogenesis
    103741989 (Adcy5)
   04915 Estrogen signaling pathway
    103741989 (Adcy5)
   04914 Progesterone-mediated oocyte maturation
    103741989 (Adcy5)
   04921 Oxytocin signaling pathway
    103741989 (Adcy5)
   04926 Relaxin signaling pathway
    103741989 (Adcy5)
   04935 Growth hormone synthesis, secretion and action
    103741989 (Adcy5)
   04918 Thyroid hormone synthesis
    103741989 (Adcy5)
   04928 Parathyroid hormone synthesis, secretion and action
    103741989 (Adcy5)
   04916 Melanogenesis
    103741989 (Adcy5)
   04924 Renin secretion
    103741989 (Adcy5)
   04925 Aldosterone synthesis and secretion
    103741989 (Adcy5)
   04927 Cortisol synthesis and secretion
    103741989 (Adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103741989 (Adcy5)
   04270 Vascular smooth muscle contraction
    103741989 (Adcy5)
  09154 Digestive system
   04970 Salivary secretion
    103741989 (Adcy5)
   04971 Gastric acid secretion
    103741989 (Adcy5)
   04972 Pancreatic secretion
    103741989 (Adcy5)
   04976 Bile secretion
    103741989 (Adcy5)
  09156 Nervous system
   04724 Glutamatergic synapse
    103741989 (Adcy5)
   04727 GABAergic synapse
    103741989 (Adcy5)
   04725 Cholinergic synapse
    103741989 (Adcy5)
   04728 Dopaminergic synapse
    103741989 (Adcy5)
   04726 Serotonergic synapse
    103741989 (Adcy5)
   04723 Retrograde endocannabinoid signaling
    103741989 (Adcy5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103741989 (Adcy5)
  09149 Aging
   04211 Longevity regulating pathway
    103741989 (Adcy5)
   04213 Longevity regulating pathway - multiple species
    103741989 (Adcy5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103741989 (Adcy5)
   04714 Thermogenesis
    103741989 (Adcy5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103741989 (Adcy5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103741989 (Adcy5)
  09165 Substance dependence
   05030 Cocaine addiction
    103741989 (Adcy5)
   05031 Amphetamine addiction
    103741989 (Adcy5)
   05032 Morphine addiction
    103741989 (Adcy5)
   05034 Alcoholism
    103741989 (Adcy5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103741989 (Adcy5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103741989 (Adcy5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103741989 (Adcy5)
   05163 Human cytomegalovirus infection
    103741989 (Adcy5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103741989 (Adcy5)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103741989 (Adcy5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103741989
NCBI-ProteinID: XP_008841177
LinkDB
Position
Un
AA seq 1257 aa
MSGSKSVSPPGYAAQTATPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGAV
TPQQQQRLASRWRDDDDEPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRRGA
AGGGSTRAPPAGGGGSSAAAAAAAGGTEVRPRSVELGLEERRGKGRTADELEPGAVEDGE
GSGDGGSSVGSGSGPGAVLSLGACCMALLQIFRSKKFPSDKLERLYQRYFFRLNQSSLTM
LMAVLVLVCLVMLAFHAARPPLQLPYLAVLAVAVGVILVMAVLCNRAAFHQDHMGLACYA
LIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHLAI
ALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLHSQRE
NQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQ
CTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDM
IEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRI
HITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQRT
NSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESTNPEDEVDEFLGRAI
DARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIVP
HSLFMLSFYLSCFLLLALVVFVSVIYSCVKLFPIPLQTLSRKIVRSKMNSTLVGVFTITL
VFLSAFVNMFMCNSKNLVGCLAEEHNITMREVNACHVVESAFNYSLGDEQGFCSSPRPNC
NFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLVTA
NAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQATE
EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFY
VELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAG
KTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVN
VASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagacagcgacgccggca
ccccggggaggccccgagcatcgctccgcgtggggagaagccgattcccgcgccaatggc
tacccccacgccccggggggttcggcccgcggctccaccaagaaacccgggggggcggtg
accccgcagcagcagcagcgcctggccagccgctggcgcgacgacgatgacgagcctccg
ctgagtggcgacgaccccctggccgggggcttcggcttcagcttccgttccaagtcggct
tggcaggagcgcggcggcgacgactgcggtcgcggcagccggcgacagcgaaggggtgcg
gctggagggggcagcacacgggcgccccctgcgggtggcggcggcagctccgcggccgcg
gcggctgcagcgggtgggacagaagtgcgtccacgatctgtggagctgggcctggaggag
cggcggggcaagggccgcacagccgacgaactggagccgggtgccgtcgaggacggcgaa
gggtccggggatggcggcagctccgtggggtcaggttctgggcccggcgcggtgctgtcg
ttgggcgcctgctgcatggccttgctgcagatattccgctctaagaagttcccgtcggac
aaactggagcggctgtaccagcgctacttcttccgcctgaaccagagcagcctcaccatg
ctcatggccgtgctggtactcgtgtgcctggtcatgctggctttccacgcagcgcggccc
ccgctccagctaccctacctggccgtgctggcggtcgccgtgggcgtgatcctcgtcatg
gccgtgctctgcaaccgtgcagccttccaccaggaccacatgggcctggcctgctatgcg
ctcatcgcagtggtgctggccgtccaggtggtaggcctgttgctgccacagccacgcagc
gcctctgagggcatatggtggaccgtgttcttcatctataccatctatacactgctgcct
gtgcgcatgcgggccgccgtgctcagcggggtgctcctgtctgccctccacctggccatc
gctctgcgcaccaacgcccaggaccagttcctgctaaagcagcttgtctccaatgtcctc
atcttctcctgtaccaacatcgtaggtgtctgcacccactacccagctgaagtctcccag
agacaggccttccaggagacccgggagtgcatccaggctcggctccactcacagcgggag
aaccagcaacaggagcgtctcctgctgtctgtccttccccgtcatgttgccatggagatg
aaagcagacatcaatgccaagcaggaggatatgatgttccacaagatttacatccagaaa
catgacaatgtgagcatcctgtttgctgacatcgaaggcttcaccagcctggcatcccag
tgtactgcccaggaacttgtcatgaccctcaatgagctcttcgcccgctttgacaagttg
gctgcggagaatcactgtttacggattaagatcctgggggattgttactactgcgtttcg
gggctgcctgaagccagggccgaccatgcccactgctgcgtagagatgggcatggacatg
atcgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaacatgcgagtggga
attcacagcgggagagtacactgcggtgtccttggtctcaggaagtggcagttcgacgtc
tggtctaatgatgtcacgctggccaaccacatggaggctggtggcaaggcaggacgcata
cacatcaccaaggccacactcaactacctgaacggggactatgaggtggagccaggctgc
ggcggcgagcgcaatgcctacctcaaggagcacagcatcgagaccttcctcatcctgcgc
tgcacccagaagcggaaagaagagaaagccatgattgccaagatgaaccgccagagaacc
aactccatcgggcacaacccaccccactggggagccgagcgccccttctacaaccacttg
ggtggcaaccaggtgtccaaggagatgaagaggatgggctttgaagacccaaaggacaag
aatgcccaggaaagtacaaaccctgaggatgaagtggatgagtttctgggccgggccatt
gatgccaggagcattgacaggctgcggtctgaacatgtccgcaagttcctcttgaccttc
agggagcccgacttagaaaagaagtactccaagcaggtggatgaccgatttggtgcctat
gtggcgtgtgcctcactcgttttcctcttcatctgctttgtccagatcaccattgtgccc
cactccctgttcatgctgagtttctacctgtcctgtttcctgctgcttgccttggtggta
ttcgtgtctgtgatctactcctgtgtgaagctctttcccattcccctgcagaccctctcc
aggaagattgtgcggtccaagatgaacagcaccctggtcggggtgttcaccatcaccctg
gtgttcctttcggcttttgtcaacatgttcatgtgcaattccaagaacctggtaggctgc
ctggcagaggaacacaacatcacgatgagagaggtcaacgcgtgccatgtagtggagtcg
gccttcaactacagcctgggtgatgaacagggcttctgcagcagcccccggcccaactgc
aacttcccggagtacttcacctacagcgtgctgctcagtctgctggcctgctccgtgttc
ctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctcatctatgta
ctcatcgtcgaggtgccgggcgtcacactctttgacaatgctgacctgctggtcaccgcc
aacgccatagacttcagcaacaatgggacctcccagtgccctgagcatgcgaccaaggtg
gcactgaaggtggtgacaccaatcatcatctctgtcttcgtgctggccctgtacctgcat
gctcagcaggtggagtccactgctcgcctggacttcctctggaaactgcaggccacggag
gagaaggaagagatggaggagctgcaggcctacaaccggaggctgctccacaacatcttg
cccaaggacgtggctgcccacttcttggcccgtgagcggcgcaacgatgaactctactat
cagtcttgtgagtgtgtggctgtcatgtttgcctctatcgccaacttctccgaattctat
gtggagctggaggccaacaatgagggcgtcgagtgcctgcggctgctcaacgagatcatc
gctgactttgatgagatcatcagcgaggatcgattcaggcagttggaaaagatcaagacc
atcggtagcacctacatggctgcctctggcctcaatgactccacctatgacaaggcaggc
aagacccacatcaaagccctggctgactttgctatgaaactgatggaccaaatgaagtac
atcaacgagcactccttcaacaacttccagatgaagatcgggctcaacattggccctgtg
gtggccggggtcattggagctcgcaagcctcagtacgatatctggggcaatacagtgaat
gtggccagccgcatggatagcactggggtgcctgaccgcatccaggttactacagatatg
taccaggtgctggccgccaacacataccagctggagtgccggggtgtggtcaaagtcaag
ggcaagggtgagatgatgacctacttcctcaatggagggccccccctcagttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743923
Entry
103743923         CDS       T03372                                 

Gene name
Adcy8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103743923 (Adcy8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103743923 (Adcy8)
   04371 Apelin signaling pathway
    103743923 (Adcy8)
   04020 Calcium signaling pathway
    103743923 (Adcy8)
   04072 Phospholipase D signaling pathway
    103743923 (Adcy8)
   04024 cAMP signaling pathway
    103743923 (Adcy8)
   04022 cGMP-PKG signaling pathway
    103743923 (Adcy8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103743923 (Adcy8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103743923 (Adcy8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103743923 (Adcy8)
   04062 Chemokine signaling pathway
    103743923 (Adcy8)
  09152 Endocrine system
   04911 Insulin secretion
    103743923 (Adcy8)
   04923 Regulation of lipolysis in adipocytes
    103743923 (Adcy8)
   04912 GnRH signaling pathway
    103743923 (Adcy8)
   04913 Ovarian steroidogenesis
    103743923 (Adcy8)
   04915 Estrogen signaling pathway
    103743923 (Adcy8)
   04914 Progesterone-mediated oocyte maturation
    103743923 (Adcy8)
   04921 Oxytocin signaling pathway
    103743923 (Adcy8)
   04926 Relaxin signaling pathway
    103743923 (Adcy8)
   04935 Growth hormone synthesis, secretion and action
    103743923 (Adcy8)
   04918 Thyroid hormone synthesis
    103743923 (Adcy8)
   04928 Parathyroid hormone synthesis, secretion and action
    103743923 (Adcy8)
   04916 Melanogenesis
    103743923 (Adcy8)
   04925 Aldosterone synthesis and secretion
    103743923 (Adcy8)
   04927 Cortisol synthesis and secretion
    103743923 (Adcy8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103743923 (Adcy8)
   04270 Vascular smooth muscle contraction
    103743923 (Adcy8)
  09154 Digestive system
   04970 Salivary secretion
    103743923 (Adcy8)
   04971 Gastric acid secretion
    103743923 (Adcy8)
   04972 Pancreatic secretion
    103743923 (Adcy8)
   04976 Bile secretion
    103743923 (Adcy8)
  09156 Nervous system
   04724 Glutamatergic synapse
    103743923 (Adcy8)
   04727 GABAergic synapse
    103743923 (Adcy8)
   04725 Cholinergic synapse
    103743923 (Adcy8)
   04720 Long-term potentiation
    103743923 (Adcy8)
   04723 Retrograde endocannabinoid signaling
    103743923 (Adcy8)
  09157 Sensory system
   04742 Taste transduction
    103743923 (Adcy8)
   04750 Inflammatory mediator regulation of TRP channels
    103743923 (Adcy8)
  09149 Aging
   04211 Longevity regulating pathway
    103743923 (Adcy8)
   04213 Longevity regulating pathway - multiple species
    103743923 (Adcy8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103743923 (Adcy8)
   04714 Thermogenesis
    103743923 (Adcy8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743923 (Adcy8)
  09165 Substance dependence
   05032 Morphine addiction
    103743923 (Adcy8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103743923 (Adcy8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103743923 (Adcy8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103743923 (Adcy8)
   05163 Human cytomegalovirus infection
    103743923 (Adcy8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103743923 (Adcy8)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103743923 (Adcy8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 103743923
NCBI-ProteinID: XP_008843712
LinkDB
Position
Un
AA seq 1250 aa
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFILGHRGGGGG
SGGSRKTSNPAGSGPNHHAPQLSGDSALPLYSLGPGERAHNTGSTKVFPERSGSGSGSGS
GGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKS
EVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTY
LQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSL
LQVILQLVIPRLPVFSINQVLAQGVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARL
RLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVK
GFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHC
CVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLE
SGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDI
VKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQ
SGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFI
VLLFITAIQSLLPSSRLVPMTIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINET
YLARNVIIFASILINFLGAVLNILWCDFDKSISLKNLTFNSSAGFTDICSYPEYFVFTGV
LAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNVNHSGEDFLGTKEAS
LLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVAR
HFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDEL
LGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALAESIQEINRHS
FNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILK
DQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ
SLNRQRQKQLLNENSNTGIIKGHYNRRTLLTPSGPEPGAQAEDSDKSDLP
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggagctctcggatgtgcgctgccttagcggcagcgaggaactctacaccattcacccg
acgcccccggccggcgacggcgggagcggttctcggccgcaaaggttgctgtggcagacg
gcggtgcggcacatcaccgagcagcgcttcatccttgggcaccggggcggcggcggcggg
agcgggggctcacgcaaaacctctaaccctgccggcagcgggcccaaccaccacgcgccg
cagctgtctggcgactcggcgctgcccctctattctctgggcccgggggagagagcgcac
aacaccggcagcacgaaagtcttcccggaacgcagcgggagcggcagtggcagtggcagc
ggaggcgggggcgatctgggcttcctgcaccttgactgtgccccgagcaactcagatttc
ttccttaatgggggctacagctaccgaggggttattttccccaccctgcgcaactcgttc
aagtctcgggatctggagcgtctctaccagcgctatttcctgggtcagaggcgcaaatct
gaggtggtgatgaacgtgctggatgtgctaaccaaactcacgctcttggtcctccacttg
agcctagcctcggccccaatggacccgctcaagggcatcttgctgggcttcttcactggc
atcgaggtggtgatctgcgcactcgtggtggtcaggaaggacaccacctcgcatacctac
ctgcaatacagcggcgtggtcacttgggtggctatgaccacccagatcctggcagccggc
cttggctatgggcttttgggagatggcataggctatgtactctttacgctcttcgccacc
tacagcatgcttccgctgccgctcacctgggccatcctagccggcctgggcacttcgctg
ctacaagtgatcctccaactggtcatcccccgactgccggtcttttccatcaaccaggtc
ttggcccagggggtgctattcatgtgcatgaacacagctggaatcttcatcagttacctg
tccgaccgtgcccagcgccaagccttcctggagacacggaggtgtgtggaggccaggctg
cgcctggagacagagaaccagagacaggagcgactcgtgctgtctgttctccccaggttt
gtggtcctggaaatgatcaatgacatgaccaatgtggaggacgagcacctgcagcatcag
ttccatcgcatctatattcatcgctatgagaatgtcagtattctttttgcagatgttaaa
ggatttaccaacctctctacgaccttgtctgctcaggagctggtcaggatgctcaacgag
ctctttgccagatttgatcggctggcccatgagcatcattgccttcgcattaaaatccta
ggggactgctactactgcgtctctggactgcctgagccccgccaggaccatgcccactgc
tgtgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgagatccagaactaag
catgatgttgacatgcgaattggaatccattccggctcagtgctatgtggtgtgttgggc
ttgcggaaatggcagtttgatgtctggtcttgggatgtggacatagcgaacaaactggaa
tctggaggaatccctgggagaattcacatttccaaagccacactggactgcctcaatggt
gactacaatgtggaagagggccatggtaaagagaggaatgaattcttaaggaagcataat
atagagacctatttgattaagcagcctgaggagagtttgctgtccttgcctgaagacatt
gtcaaggagtctgtgagttcctcagacaggagaaacagtggggccacattcactgaagga
tcctggagcccagaactgccttttgataacatcgtgggaaaacagaatactctggctgcc
ctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtccag
tctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggcgat
aaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctggag
cacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcgtttata
gttcttctgtttatcaccgcaattcaaagcttgcttccttcttcaagactggtgccgatg
accattcagttctccatcctcatcatgctgcactctgccctggtcctcatcacgacagca
gaagactacaagtgtctgcccctcgtcctccggaaaacctgctgttggatcaatgaaacc
tatctggcccggaacgtcatcatctttgcttccatcttgattaatttcctgggtgccgtc
ctaaatattctgtggtgtgattttgacaagtcgatatccttgaagaacctgactttcaat
tcctcagctgggtttacagatatctgctcctacccagagtacttcgttttcactggagta
ttggccatggtgacctgtgcagtttttctccggcttaactccgtcctgaagctggctgtg
ctgctaattatgatcgccatttacgccctgctgactgagaccatctacgcaggtcttttt
ctgcgttatgacaacgtgaaccacagtggagaagatttcctggggaccaaagaggcgtcc
ctgctgctgatggccatgttcctccttgctgtgttctaccatggacagcagctggagtac
acagcccgcctggacttcctgtggcgagtacaggccaaagaggagatcaatgagatgaag
gaacttagagaacacaatgaaaacatgctgcgcaatatcttgcccagccacgtggcccgt
catttcctggagaaggaccgagacaatgaggaactgtattctcagtcctatgatgctgtt
ggggtgatgtttgcctccatcccaggatttgcagacttttactctcagactgaaatgaac
aaccaaggagtggaatgcctgcgcttgctgaatgagatcatcgctgactttgacgagttg
cttggagaagaccggtttcaagacattgaaaaaattaagaccattggtagcacctacatg
gctgtctcaggcctgtcaccagaaaaacagcaatgtgaagacaagtggggacatttgtgt
gccctggctgacttctctctagcactggctgaaagcatacaagagatcaacaggcattcg
ttcaacaatttcgagctccggattggcatcagccatggctcagtggtagctggtgtgatc
ggcgctaagaaaccacagtatgacatttggggtaaaactgtgaacttggcaagccggatg
gacagcacaggagtgagtggccggatccaagtccctgaggagacctatctcatcctgaag
gaccagggcttcgcctttgactaccgaggggagatctatgtgaagggcatcagtgagcaa
gaagggaaaatcaaaacatactttcttctgggaagagtccaacccaacccatttatcttg
cctccaagaagactacccgggcagtactccctggctgcggttgtccttggccttgtccag
tctctcaataggcaaaggcagaaacaactactcaatgaaaacagcaacacaggcatcatc
aagggccattacaaccggcggactttgttgacacccagtgggccagagcctggagcccaa
gctgaagacagcgacaaatccgatttgccataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744458
Entry
103744458         CDS       T03372                                 

Gene name
Adcy9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103744458 (Adcy9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103744458 (Adcy9)
   04371 Apelin signaling pathway
    103744458 (Adcy9)
   04020 Calcium signaling pathway
    103744458 (Adcy9)
   04072 Phospholipase D signaling pathway
    103744458 (Adcy9)
   04024 cAMP signaling pathway
    103744458 (Adcy9)
   04022 cGMP-PKG signaling pathway
    103744458 (Adcy9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103744458 (Adcy9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103744458 (Adcy9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103744458 (Adcy9)
   04062 Chemokine signaling pathway
    103744458 (Adcy9)
  09152 Endocrine system
   04911 Insulin secretion
    103744458 (Adcy9)
   04923 Regulation of lipolysis in adipocytes
    103744458 (Adcy9)
   04912 GnRH signaling pathway
    103744458 (Adcy9)
   04913 Ovarian steroidogenesis
    103744458 (Adcy9)
   04915 Estrogen signaling pathway
    103744458 (Adcy9)
   04914 Progesterone-mediated oocyte maturation
    103744458 (Adcy9)
   04921 Oxytocin signaling pathway
    103744458 (Adcy9)
   04926 Relaxin signaling pathway
    103744458 (Adcy9)
   04935 Growth hormone synthesis, secretion and action
    103744458 (Adcy9)
   04918 Thyroid hormone synthesis
    103744458 (Adcy9)
   04928 Parathyroid hormone synthesis, secretion and action
    103744458 (Adcy9)
   04916 Melanogenesis
    103744458 (Adcy9)
   04925 Aldosterone synthesis and secretion
    103744458 (Adcy9)
   04927 Cortisol synthesis and secretion
    103744458 (Adcy9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103744458 (Adcy9)
   04270 Vascular smooth muscle contraction
    103744458 (Adcy9)
  09154 Digestive system
   04970 Salivary secretion
    103744458 (Adcy9)
   04971 Gastric acid secretion
    103744458 (Adcy9)
   04972 Pancreatic secretion
    103744458 (Adcy9)
   04976 Bile secretion
    103744458 (Adcy9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103744458 (Adcy9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103744458 (Adcy9)
  09156 Nervous system
   04724 Glutamatergic synapse
    103744458 (Adcy9)
   04727 GABAergic synapse
    103744458 (Adcy9)
   04725 Cholinergic synapse
    103744458 (Adcy9)
   04723 Retrograde endocannabinoid signaling
    103744458 (Adcy9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103744458 (Adcy9)
  09149 Aging
   04211 Longevity regulating pathway
    103744458 (Adcy9)
   04213 Longevity regulating pathway - multiple species
    103744458 (Adcy9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103744458 (Adcy9)
   04714 Thermogenesis
    103744458 (Adcy9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103744458 (Adcy9)
  09165 Substance dependence
   05032 Morphine addiction
    103744458 (Adcy9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103744458 (Adcy9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103744458 (Adcy9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103744458 (Adcy9)
   05163 Human cytomegalovirus infection
    103744458 (Adcy9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103744458 (Adcy9)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103744458 (Adcy9)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 DUF512 zf-C2HC_2
Other DBs
NCBI-GeneID: 103744458
NCBI-ProteinID: XP_008844447
LinkDB
Position
Un
AA seq 1371 aa
MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNIHPKHCKYSISSSCSSSGDS
GGLPRRVAGGSRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYVGFACLLWSIYFSVHMRSKLIVMVVPALCFLVVCVGFFMFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVWTPLSGRVDSSNHTPTAKAADTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFSYHFRNEDCFLSPGPAALHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSIKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEVIDGSRAS
SGPRGQGTASSGSVSDLAQTVKPFDNLKTCPSCGITFAPKSEVGAEGGTVQNGCQDEPKT
STKVTSSWLLFLSVPLLAHPPKASGGPNSKTQNGLLSPPAEKLTNSQTSLCEILQEKGRW
AGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERS
YRTSYQEEVIKNSPVKTFASATFSSLLDVFLSTTVFLILSVTCFLKYGATATPLSSAALA
VFGANLLLEVLSLVVSIRMVFFLEDVMTCTKRLLEWIAGWLPRHCIGAILVSLPALAVYS
HITSEFETNIQFTMFTGSAVLVAVVHYCNFCQLSSWMRSSLATIVGAGPLLLFYISPCPD
SSIVMSALDTAQNFSVERNPCNSSLLQDSRRPANLVGKELILAFFLLLLLVWFLNREFEV
SYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFA
SIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNT
AQCQEGGHPQEHLRILFEFAKEMMHVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKL
LYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLY
PKCMDNGVVPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPSVQYSDKTSLGSDDNTQAK
DVHLSSKRPWREPVKAEERCRFGKAIEKDDCEDTGIEEANELTKLNVSKSV
NT seq 4116 nt   +upstreamnt  +downstreamnt
atggcttcctcaccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggagacagcaacagcgtgagggtcaagatcaaccccaaacagctgtcttccaac
atccaccccaagcactgcaagtacagcatctcctccagctgtagcagctcgggggattcc
ggggggcttcccaggcgggtggccggcgggagccgtctgcgccggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggatcccaagttcgactccgtgaacctg
gaggaggcctgcttggagcgctgcttcccgcagacccagcgccgcttccggtacgcactc
ttctacgtgggctttgcctgccttctctggagcatctatttctctgtccacatgagatct
aagctgattgtcatggtggtccccgctctgtgcttcctggtggtgtgcgtgggttttttt
atgtttactttcaccaagctgtatgcccggcattacgcgtggacctcgctggcgctcacc
ctgctggtgttcgccttgaccctggctgcccagtttcaggtttggacgcctctgtcagga
cgtgttgacagctccaatcatactcccacagccaaggcggcagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtatctgagcttgtttttgggagtggcctattctgttctttttgagaccttcagc
tatcatttccgaaatgaagactgcttcctttcccctggccctgcggccctgcactgggaa
ttgctgagcagggccttgctccatgtgtgcatccatgccatcgggatccatctcttcatc
atgtctcaggtgaggtccagaagcaccttcctcaaggtgggacaatccattatgcacggc
aaagatctggaagtagaaaaagctctcaaagagaggatgattcattctgtgatgccaaga
atcatcgctgatgacttaatgaagcagggggatgaggagagtgagaattccatcaagagg
catgccacctccagccctaagaacaggaaaaagaagtcttccatacagaaagctcctata
gcattccgcccctttaaaatgcagcagattgaagaagtcagtattttatttgcagacatc
gtgggcttcaccaagatgagtgccaacaagtctgcacatgccttggtgggtctcctcaat
gatctattcggtcgctttgaccggctgtgtgaggagaccaaatgcgagaagatcagcact
ctgggagactgttactattgtgtggcaggatgtccagagcctcgggcagaccatgcctac
tgctgcattgaaatgggcttgggcatgataaaagccattgagcagttctgccaggagaag
aaagaaatggtgaacatgcgtgttggggttcacacagggactgtcttgtgtggcatcctg
ggcatgaggaggtttaaatttgacgtatggtccaatgatgtgaacttggccaatctcatg
gagcagcttggagtagctggcaaagttcacatatctgaggccactgcaaaatacttagat
gataggtacgaaatggaagatgggagagttaccgaacgccttggtcagagtgtggttgct
gatcagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtcccac
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacgggcgtcc
tcaggccctaggggacaggggacagcatcatcagggagtgtcagtgacttggcgcagact
gtcaaaccctttgataaccttaagacttgtccttcatgtggaatcacatttgctcccaaa
tctgaagttggtgcagaaggaggaactgtacaaaacggctgtcaagacgagcccaagacc
agcaccaaggtaacaagctcatggctgttgttcctgtcagttcctctcctggcgcatcca
cctaaggcttctggaggacccaactccaaaacccagaatggactcctgagccctccagca
gagaagctcaccaacagccagacctccctatgtgagatcctgcaggagaagggacggtgg
gcaggtgtgagcttggaccagtcagccctcctcccactgaggttcaagaatatccgtgag
aaaactgatgcccattttgtggatgttatcaaagaagacagcctgatgaaagattatttt
ttcaagccgcccatcaatcaattcagcctgaacttcctggatcaggagctggagcgatcc
tacaggaccagctaccaggaagaggtcataaagaattctcccgtgaagacttttgcaagt
gctaccttcagctccctcctggatgtgtttctgtccaccacagtgttcctgatcctctct
gttacttgcttcctgaagtatggggccactgccacacctctctcatctgctgccctggct
gtctttggtgcaaatctactgctggaggtgctgtctctagtagtgtccatcaggatggtg
ttcttcctggaggatgtcatgacatgcacaaagcggttgctggaatggatcgctggctgg
ctccctcgccactgcatcggggccatcctggtgtccctacctgccttggctgtctactct
cacatcacctccgagtttgagacgaacatacaattcaccatgttcactggttctgctgtg
ttggtggcggttgtgcactactgtaacttctgccaacttagctcctggatgaggtcttcc
cttgccaccattgtgggggctgggccactgcttctgttctacatctccccatgcccagac
agttccatagtaatgtcagccctggatacagcacagaatttcagtgttgagaggaaccca
tgcaacagctcactgctgcaggatagcaggaggccagccaacctcgtaggcaaggaactc
atcctcgccttcttcctcctgctcctcttggtctggttcctgaacagagagttcgaggtc
agctaccgcctgcactaccatggggatgtggaagcagatctccaccgcactaagatccaa
agcatgagggaccaggctgactggctactgaggaacatcatcccctaccatgtggctgag
cagctgaaagtttcccagacctactccaagaaccacgatagtggaggtgtgatcttcgcc
agcattgtaaacttcagtgagttctatgaggagaactacgaagggggcaaggagtgctac
cgggtcctcaatgagctgattggtgactttgatgagctcctgagcaagccagactacaac
agcattgaaaagatcaagaccattggggccacatacatggcagcatcagggctgaacacg
gcccagtgtcaggaaggtggccacccacaggagcatctacggatcctgttcgagttcgcc
aaggagatgatgcatgtggtagatgacttcaataacaacatgctgtggttcaacttcaag
ctcagagttggctttaatcatgggccccttacagcaggtgtcattggcaccaccaagctg
ctgtacgacatctggggggacactgtcaacattgccagcaggatggataccactggggtt
gagtgccgcatccaggtgagcgaagagagctaccgtgtgctgagcaagatgggctatgac
tttgactaccgcgggactgtgaatgtcaaggggaaaggacagatgaagacctacctttac
ccaaagtgcatggataatggggttgtgccacagcaccagctgtccatctccccagacatc
cgagtacaggtggatggcagcattggacggtctcccacagatgagattgccaacctggtg
ccttctgtccagtattcggacaagacttccctgggctctgatgacaacactcaggccaag
gatgtgcacctgtcctctaagagaccctggagagagccagtcaaagccgaagagaggtgt
cgatttggcaaagccatagaaaaagatgactgtgaagacacaggaatagaagaagccaat
gaactcaccaagctcaatgtctcaaagagtgtatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746460
Entry
103746460         CDS       T03372                                 

Gene name
Adcy3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04740  Olfactory transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103746460 (Adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103746460 (Adcy3)
   04371 Apelin signaling pathway
    103746460 (Adcy3)
   04020 Calcium signaling pathway
    103746460 (Adcy3)
   04072 Phospholipase D signaling pathway
    103746460 (Adcy3)
   04024 cAMP signaling pathway
    103746460 (Adcy3)
   04022 cGMP-PKG signaling pathway
    103746460 (Adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103746460 (Adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103746460 (Adcy3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103746460 (Adcy3)
   04062 Chemokine signaling pathway
    103746460 (Adcy3)
  09152 Endocrine system
   04911 Insulin secretion
    103746460 (Adcy3)
   04923 Regulation of lipolysis in adipocytes
    103746460 (Adcy3)
   04912 GnRH signaling pathway
    103746460 (Adcy3)
   04913 Ovarian steroidogenesis
    103746460 (Adcy3)
   04915 Estrogen signaling pathway
    103746460 (Adcy3)
   04914 Progesterone-mediated oocyte maturation
    103746460 (Adcy3)
   04921 Oxytocin signaling pathway
    103746460 (Adcy3)
   04926 Relaxin signaling pathway
    103746460 (Adcy3)
   04935 Growth hormone synthesis, secretion and action
    103746460 (Adcy3)
   04918 Thyroid hormone synthesis
    103746460 (Adcy3)
   04928 Parathyroid hormone synthesis, secretion and action
    103746460 (Adcy3)
   04916 Melanogenesis
    103746460 (Adcy3)
   04925 Aldosterone synthesis and secretion
    103746460 (Adcy3)
   04927 Cortisol synthesis and secretion
    103746460 (Adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103746460 (Adcy3)
   04270 Vascular smooth muscle contraction
    103746460 (Adcy3)
  09154 Digestive system
   04970 Salivary secretion
    103746460 (Adcy3)
   04971 Gastric acid secretion
    103746460 (Adcy3)
   04972 Pancreatic secretion
    103746460 (Adcy3)
   04976 Bile secretion
    103746460 (Adcy3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103746460 (Adcy3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103746460 (Adcy3)
   04727 GABAergic synapse
    103746460 (Adcy3)
   04725 Cholinergic synapse
    103746460 (Adcy3)
   04723 Retrograde endocannabinoid signaling
    103746460 (Adcy3)
  09157 Sensory system
   04740 Olfactory transduction
    103746460 (Adcy3)
   04750 Inflammatory mediator regulation of TRP channels
    103746460 (Adcy3)
  09149 Aging
   04211 Longevity regulating pathway
    103746460 (Adcy3)
   04213 Longevity regulating pathway - multiple species
    103746460 (Adcy3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103746460 (Adcy3)
   04714 Thermogenesis
    103746460 (Adcy3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746460 (Adcy3)
  09165 Substance dependence
   05032 Morphine addiction
    103746460 (Adcy3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103746460 (Adcy3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103746460 (Adcy3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103746460 (Adcy3)
   05163 Human cytomegalovirus infection
    103746460 (Adcy3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103746460 (Adcy3)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103746460 (Adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 103746460
NCBI-ProteinID: XP_008846872
LinkDB
Position
Un
AA seq 1144 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLVLDII
LFVLCKKGLLPDRVSRKVVPYLLWLLITAQIFSYLGLNFSRAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELQGMQLLREILANVFLYLCAIIVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTAQNGLNGSALPNGAPMSSKPSSPALIETKEPNGSTHAS
GSMSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLFCTAMVEILIDPWLMTNY
VTFVVGEVLLLILTICSLAAIFPRAFPKKLVAFSSWIDRTRWARNTWAMLAIFILVMTNV
VDVLSCLQYYMGPYNGTAGIELDGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLML
LVTGAVTAINLYAWCPVFDEYDHKRFQEHDSPMVALEKMQVFSTPGLNGTDRLSLMPSKY
SMTVMMFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcagatcccgagtactcggcagagtactcagccgagtac
tccgtcagcctcccctcagaccctgaccgcggggttggccggacccatgaaatctccgtg
cggaactcgggatcctgcctgtgcctgccgcgcttcatgcggctgaccttcgtgccagag
tccttagagaacctctaccagacctacttcaagaggcagcgccatgagacgctgctggtc
ttggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgctgtggtcttc
tccagcgacaagctagctcccctcgtcgtggctgggatcgggctggtgttggacatcatc
ctctttgtgctctgcaaaaaggggctcctcccggaccgcgtgagccggaaggtggtaccc
tacctgctgtggctgctcatcacagctcagatcttctcctacctgggcctgaacttctcc
cgtgcccatgcagccagcgacactgtgggctggcagaccttctttgtcttttctttcttt
atcacgttgcccctcagcctcagccccatcgtgatcatctctgtggtctcctgtgttgtg
cacacgctggtcttgggggtcaccgtggctcagcagcagcaggaggagcttcaagggatg
cagctgctgagggagatcctggccaatgtcttcctctacttgtgcgccatcatcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgtaaagccttcctggaggcccgccag
tcactggaggtgaagatgaacctggaggagcagagccagcaacaggagaaccttatgctt
tccatcctgcccaagcatgtggctgatgagatgttgaaggacatgaagaaagatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcatgagaacgtcagcatc
ctgtttgcagatattgtgggtttcacccagctgtcctctgcctgcagtgcccaggagctc
gtaaaactactcaacgagctctttgcccgctttgacaagctggcggctaaataccaccag
ctgcggatcaagatcctgggagactgttactactgcatctgtgggctgccggactaccgg
gaggaccatgctgtgtgctccatcctcatgggcctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagacgggagtggacatgcgtgtgggggtacacacaggcactgtg
ctaggtggcgtcctgggccagaaacggtggcagtatgatgtgtggtccactgatgtcact
gtggctaacaagatggaggctggaggtattccagggcgagtgcacatctctcagagcacc
atggactgcctgaaaggggagtttgacgtggagcctggtgatgggggcagccgctgtgat
tacctagaggagaagggcatcgaaacctacctcatcattgcctccaagccagaggtgaag
aaaactgcccagaatggtctcaatggctcggccctgccaaatggagccccaatgtcctcc
aagcccagctcccctgcccttattgagaccaaggaacccaatgggagcacccatgccagc
ggctccatgtcggaggaggctgaggagcaggaggcccaggccgacaacccctcgttcccc
aacccccgccgcaggctgcgcctccaggacctggcagaccgtgtggtggatgcctctgag
gatgagcacgagctcaatcagctgctcaacgaggccttgctggagcgggaatctgcccag
gtggtgaagaagagaaacaccttcctcctgaccatgcggttcatggaccctgagatggaa
acacgctactctgtggagaaggagaagcagagcggggccgccttcagctgctcctgtgtc
gtcctgttctgcacagctatggtggagatcctcattgacccctggctcatgacaaactac
gtgacctttgtggttggggaggtactgctcctgatcctgaccatctgctcactggctgcc
atctttcctagggcctttcctaagaagcttgtggccttttcatcttggatcgaccggaca
cgctgggccaggaacacctgggccatgttagccattttcattctagtcatgaccaatgtt
gtggacgtgcttagctgtctccaatactacatgggaccctacaatgggacagctgggata
gagctggatggtggctgtctggagaaccccaagtattacaactacgttgctgtgctgtcc
ctcatcgccaccatcatgctagtgcaggtcagccacatggtgaagctgacgctcatgcta
ctcgtcactggcgcggtgactgccatcaacctctatgcctggtgtcccgtctttgatgaa
tacgaccacaaacgctttcaggaacatgactctcctatggtggctttagagaagatgcag
gtattttctaccccagggctcaatggcactgacaggctgtccctgatgccttctaagtac
tcaatgacagtgatgatgttcatcatgatgctgagcttttactacttctcccgccacgtg
gaaaaactggctcggacactgttcctgtggaagattgaggtccatgaccagaaagaacgt
gtgtatgagatgcgacgatggaacgaggccttagtcaccaacatgttgcccgagcatgtt
gcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttacgat
gagattggagtcatgttcgcttccctgcccaactttgctgacttctacactgaggagagc
atcaataatggtggcattgagtgtctacgcttcctcaatgagatcatctctgacttcgac
tctctcttagataatcccaaattccgggtcatcaccaagatcaaaaccattggcagcacc
tacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctccagc
aaggaggagaagtcggataaggaacgctggcagcacctggctgacctggcggactttgca
ctagccatgaaggatacacttacaaacatcaacaaccagtcattcaacaacttcatgttg
cgcataggcatgaacaaaggaggagttcttgctggagtcattggagcccggaaaccacac
tatgacatctggggcaacacagtcaacgtggccagcaggatggagtccacaggggtcatg
ggtaacatccaggtggtagaagaaacgcaagtcatcctccgagaatatggcttccgcttt
gtacgacgaggccccatctttgtgaaagggaaaggggagcttctgacctttttcttgaag
ggccgggataggccggctgccttccctaatggctcctctgttacactgccccaccaagtg
gtggacaactcctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750558
Entry
103750558         CDS       T03372                                 

Gene name
Adcy6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi01522  Endocrine resistance
ngi04015  Rap1 signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04114  Oocyte meiosis
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04727  GABAergic synapse
ngi04742  Taste transduction
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04923  Regulation of lipolysis in adipocytes
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04926  Relaxin signaling pathway
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04962  Vasopressin-regulated water reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi04976  Bile secretion
ngi05032  Morphine addiction
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103750558 (Adcy6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103750558 (Adcy6)
   04371 Apelin signaling pathway
    103750558 (Adcy6)
   04072 Phospholipase D signaling pathway
    103750558 (Adcy6)
   04024 cAMP signaling pathway
    103750558 (Adcy6)
   04022 cGMP-PKG signaling pathway
    103750558 (Adcy6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103750558 (Adcy6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103750558 (Adcy6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103750558 (Adcy6)
   04062 Chemokine signaling pathway
    103750558 (Adcy6)
  09152 Endocrine system
   04911 Insulin secretion
    103750558 (Adcy6)
   04923 Regulation of lipolysis in adipocytes
    103750558 (Adcy6)
   04912 GnRH signaling pathway
    103750558 (Adcy6)
   04913 Ovarian steroidogenesis
    103750558 (Adcy6)
   04915 Estrogen signaling pathway
    103750558 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    103750558 (Adcy6)
   04921 Oxytocin signaling pathway
    103750558 (Adcy6)
   04926 Relaxin signaling pathway
    103750558 (Adcy6)
   04935 Growth hormone synthesis, secretion and action
    103750558 (Adcy6)
   04918 Thyroid hormone synthesis
    103750558 (Adcy6)
   04928 Parathyroid hormone synthesis, secretion and action
    103750558 (Adcy6)
   04916 Melanogenesis
    103750558 (Adcy6)
   04924 Renin secretion
    103750558 (Adcy6)
   04925 Aldosterone synthesis and secretion
    103750558 (Adcy6)
   04927 Cortisol synthesis and secretion
    103750558 (Adcy6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103750558 (Adcy6)
   04270 Vascular smooth muscle contraction
    103750558 (Adcy6)
  09154 Digestive system
   04970 Salivary secretion
    103750558 (Adcy6)
   04971 Gastric acid secretion
    103750558 (Adcy6)
   04972 Pancreatic secretion
    103750558 (Adcy6)
   04976 Bile secretion
    103750558 (Adcy6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103750558 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103750558 (Adcy6)
  09156 Nervous system
   04724 Glutamatergic synapse
    103750558 (Adcy6)
   04727 GABAergic synapse
    103750558 (Adcy6)
   04725 Cholinergic synapse
    103750558 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    103750558 (Adcy6)
  09157 Sensory system
   04742 Taste transduction
    103750558 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    103750558 (Adcy6)
  09149 Aging
   04211 Longevity regulating pathway
    103750558 (Adcy6)
   04213 Longevity regulating pathway - multiple species
    103750558 (Adcy6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103750558 (Adcy6)
   04714 Thermogenesis
    103750558 (Adcy6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750558 (Adcy6)
  09165 Substance dependence
   05032 Morphine addiction
    103750558 (Adcy6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103750558 (Adcy6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103750558 (Adcy6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103750558 (Adcy6)
   05163 Human cytomegalovirus infection
    103750558 (Adcy6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103750558 (Adcy6)
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103750558 (Adcy6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103750558
NCBI-ProteinID: XP_008851878
LinkDB
Position
Un
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRHGTRASGFCAPCYMSCFKDAEPPSPTPAAPT
RCPWQDEAFIRRAGPGRGMELGLRSVALGFDDTEVTTPVGTAEVAPDVAPRSGRSCWHHL
VRVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTVVLLTFHAAPAPPQPAYVA
LLTCAAALFVALMVVCNRQSFHQDSMWVVSYVVLGILAVVQVGGAVAANPHSPSAGLWCP
VFFVYVTYTLLPIRMRAAVLSGLGLSTLHLILAWYLNRGDPFLWKQLGANMVLFLCTNVI
GICTHYPAEVSQRQAFRETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQRIETFLILGASQKRKEEKAMLAKLQRTRANSLEGLMPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQFLIFPHSMLMLGVYSGLFLLLLVTVLICAVCSCGS
LFPKVLQRLSRSIVRSRVHSTAVGIFSVLLVFISAIANMFTCNHTPIRTCAARMLNLTPA
DITTCHLQQLNYSLGLDAPLCEGTAPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMT
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCSAVGRVALKYMAPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
REHRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHVTALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcatggtttagcggcctcctggttcccaaagtggatgaaagaaaaacagcttggggt
gaacgaaatgggcagaagcgcccacgacatgggactcgggccagtggcttctgtgcaccc
tgctacatgagctgcttcaaggatgcagagccacccagccccacccctgcggctcctact
cggtgtccctggcaggacgaggccttcatcaggagagccggcccaggcaggggtatggag
ctggggctgcgatcagtggccttgggtttcgatgacactgaggtgacaacgccagtaggg
acggctgaagtggcacctgatgtggcacctaggagtgggcgatcctgttggcaccatctg
gtgcgagtgttccagtcgaagcagttccgctccgccaagctggagcgcctgtaccagcgc
tactttttccagatgaaccagagcagcctcacactgctcatggcagtgcttgtgctgctc
accgtcgtgctgctgacctttcacgccgcacctgctccgcctcagcccgcctatgtggcc
ctgctgacctgtgccgctgccctctttgtggcactcatggtggtgtgcaaccgacaaagc
ttccaccaggactccatgtgggtggtgagctatgtggtgttgggcatcctggcagttgta
caggtcgggggtgccgtggcagcgaacccacacagcccttctgcaggcctctggtgccct
gtgttctttgtctatgtcacctacacgctcctgcccatccggatgcgagctgctgtgctc
agcggcctgggcctctccaccttacatttgattttggcctggtatctcaaccgtggtgat
cccttcctctggaagcagctcggtgctaacatggtgctcttcctctgcaccaacgtcatt
ggcatctgcacacactaccctgctgaagtgtctcagcgccaggcctttcgggagacccga
ggttatatccaggctcggttgcacctgcagcatgagaatcgccagcaggagcggctgctg
ctatcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaaaaaa
gaagacatgatgttccataagatctacatccagaagcacgataatgtcagcatcctattt
gcggacattgagggcttcaccagcctggcctcccagtgcactgcacaggagctggtcatg
accttgaacgagctctttgcccggtttgacaagctggctgcggaaaatcattgtctgagg
atcaagatcttaggagactgttactactgtgtgtcagggctgcctgaggcccgggcagac
catgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtgcgt
gaagtaacaggtgtaaatgtgaacatgcgtgtgggcatccacagtggacgtgtacactgt
ggtgttcttggtctgcggaaatggcagtttgatgtgtggtccaatgatgtgaccctggcc
aaccacatggaggctgggggccgtgctggccgtattcacatcactcgggccacactgcag
tacctgaatggcgattatgaggtggagccgggtcgcggtggtgagcgcaatgcatacctc
aaggagcagcgcattgagaccttcctcatattgggcgccagccagaaaaggaaagaggag
aaggctatgttggccaagctgcagcggacaagggccaactccctggaagggctgatgcca
cgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggcattccgccagatg
ggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccctgaagat
gaagtggacgagttcctgggccgtgccatcgatgcccgtagcattgaccaactgcgtaag
gaccatgtacgccggttcctgctcactttccagagagaagatctcgagaagaagtactca
aggaaggttgatccccgctttggagcctacgtcgcctgtgccctattggtcttttgcttc
atctgcttcatccagttcctcatattcccacactccatgctgatgctcggggtctattcc
ggtctcttcctgctcttgctggtcactgtgctgatctgtgctgtgtgctcctgtggctct
ctcttcccgaaggtcctacagcgcctgtctcgcagcatcgtccgctcacgggtgcatagc
acagcagttggcatattttcagttctgcttgtgttcatctctgccatcgccaacatgttc
acctgtaatcacacccccatacggacctgcgcagcccggatgctgaatttaacacccgct
gacatcaccacctgccacctacaacagctcaattactctctgggcctggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcatcgggaacatgctgctg
agtctcttggccagctctgtcttcctgcatatcagcagcattggcaagttggctatgacc
tttgtcctggggctcatctacttggtgctgcttcttctgggtcccccagccaccatcttt
gacaactatgatctactacttggtgtccatggcttggcttcttccaatgagacctttgat
gggctggactgctcagctgtagggagggtcgcactcaaatacatggcccctgtcattctg
ctggtttttgcgctggcactgtatctgcatgcccagcaggtggagtcaactgcccgcctg
gacttcctctggaaactacaggcaacaggggagaaggaggagatggaagagctccaggca
tacaaccgacgcctgctgcataacattctgcccaaggatgtggctgcccactttctggcc
cgggagcaccgcaatgatgaactctactaccagtcgtgtgaatgcgtggctgttatgttt
gcctccattgccaacttctctgagttctatgtggagctggaggcaaacaatgagggtgtc
gagtgcctgcggctgctcaatgagatcatcgcagactttgatgagatcatcagtgaggag
agattccggcagctagaaaagatcaagacgattggcagcacctacatggctgcctctggc
ctgaacgccagcacctacgaccaggtgggccgctcccatgtcactgccctggcagactat
gccatgcgactcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagattgggttgaacatgggtccagttgtggcaggcgtcattggggcccggaagcca
cagtatgacatctggggaaacacagtgaatgtctccagtcgtatggacagcacgggggtc
cctgaccgcatacaggtgaccacggacctgtaccaggttctagctgccaagggctaccaa
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

DBGET integrated database retrieval system