KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730385Help
Entry
103730385         CDS       T03372                                 

Definition
(RefSeq) anionic trypsin-2-like
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103730385
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103730385
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103730385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 103730385
NCBI-ProteinID: XP_008826825
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MSALLILALVGAAVAFPVDDDDKIVGGYTCQKNSIPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEHNINVVEGNEQFITASKIIRHPSYSSKTLDNDIMLIKLSSPVTVN
ARVAPVSLPTSCAPAGTQCLISGWGNTLSNGVNNPDLLQCLDAPLLSQSACEAAYPGQIT
KNMVCAGFLEGGKDSCQGDSGGPVVCKGQLQGVVSWGYGCAQKGLPGVYTKVCNYVNWIQ
STIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactcctgatcttggcccttgtgggagctgctgttgctttccctgtggatgac
gatgacaagatcgtcggaggctacacctgccagaagaattccatcccctaccaggtgtcc
ctgaactctggctaccacttctgtggaggctccctcatcaacagccagtgggtggtatct
gcggctcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcaacgtc
gttgagggcaatgagcagttcatcactgcttccaagatcatccgccaccccagctacagt
agcaagacactggacaatgacatcatgctgatcaaactctcttcccctgtaaccgtcaat
gcccgggtggcccctgtatctctgcctacctcctgtgcacctgctggcactcagtgtctc
atctctggctggggcaacaccctgagcaacggtgtcaacaaccctgacctgctgcagtgc
ctggatgccccactgctgtctcagtctgcctgtgaagctgcctaccctgggcagatcacc
aaaaacatggtctgtgctggcttcctcgagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaagggacagcttcagggagtcgtctcctggggctatggctgt
gcccagaagggccttcctggagtgtacaccaaagtgtgcaactacgtgaactggattcag
tccaccattgctgccaactga

DBGET integrated database retrieval system