KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730596Help
Entry
103730596         CDS       T03372                                 

Gene name
Gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00052  Galactose metabolism
ngi00500  Starch and sucrose metabolism
ngi01100  Metabolic pathways
ngi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103730596 (Gaa)
   00500 Starch and sucrose metabolism
    103730596 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103730596 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103730596 (Gaa)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103730596 (Gaa)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103730596 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103730596
NCBI-ProteinID: XP_008827091
LinkDB All DBs
Position
Un
AA seq 952 aa AA seqDB search
MNVKRPPCSCPLVGVCILISLATAALLGHNLLHDFSLVPQELRGSFQRLEETHRAHHKRA
DGPGLRHTQEHPDQLREAAIQCDVPPSSRFDCAPDKGITQEQCEARGCCYVPVGQLPKGP
LNGQPWCFFPPDYPSYRLENLSSSEMGYTATLTRASPTFFPKDVLTLRLDVLMETESRLH
FTIKDPTNKRYEVPLETPRVLSRPSSPLYSVEFSEEPFGVIVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTEWTRITLWNRDLAPSPGANLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVVLQPRPALTWRSTGGILDVYVFLGPEPKSVVQQYQDVVGY
PFMPPYWGLGFHLCRWGYSSTTILRQVVENMTKARFPLDVQWNDLDYMDARRDFTFNKDG
FEDLPAFVQDLHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLQRGVFITNETGQPLIGKV
WPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSEQGCPNNNLEN
PPYVPGVVGGTLQAATICASSRQFLSTHYNLHNLYGLTEAIASNRALVKARGTRPFVISR
STFASHGRYAGHWTGDVWSSWEQLSYSVAEILQFNLLGVPLVGADICGFLGNTSEELCVR
WTQLGIFYPFMRNHNDLHSMPQEPYRFSETAQQAMRNAFALRYALLPYLYTLFHRAHVNG
DTVARPLFLEFPEDPSTWTVDRQLLLGPALLVTPVLEPGKTEETGYFPAGTWYNLQTVPV
EAFGSLPPLPSAAFSSAIHSKGQWVTLSTPLDTINVNLRAGYIVPLQGPDLTTTESRKQP
MALVVALTTSGEAHGELYWDDGESLGVLEQGAYTQVTFQAKNNTITNELVHVSKEGANLQ
LRSVSVVGVTTAPTQVFSNGIPVSNFTYSPDSKILAIPVSLLMGEQFRISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaagagaccaccctgctcctgccccctggtaggggtctgtatcctcatctcc
ttggccacagctgccctcctgggtcacaacctgctccatgacttctcactggtcccccaa
gagctacgtggctcctttcaaagactagaggaaactcacagagctcaccataagagagct
gatggaccagggctccgacacacccaggagcaccctgaccagctcagagaagcagccata
cagtgtgatgttccccccagtagccgcttcgattgtgccccagacaagggcatcacccag
gagcagtgtgaggcccgtggctgctgctatgtcccagtggggcagctgccaaagggcccc
ctgaacgggcagccctggtgtttcttccctcctgactatccaagctaccggctggagaac
ttgagctcctcagagatgggttacacagccaccctgacccgagccagccctaccttcttc
ccaaaggatgtgttgaccttacggctggacgtgctgatggaaactgagagccgcctccac
ttcacgatcaaagatcccactaacaagcgctacgaggtgcccctggagaccccgcgtgtc
ctgagccggccatcctccccactctacagtgtggagttctcagaggagccctttggagtg
attgtgcgcaggaagctagatggccgggtgctgctgaacacaactgtggcccctctgttc
ttcgctgaccagtttctgcagctgtccacctctctgccctcccagtacatcacaggcctc
gctgagcacctgagtccactcatgctcagcaccgaatggacccggatcaccctctggaac
cgggacctggccccctcgccaggtgccaacctctatgggtcacatcctttctacctggca
ctggaggatggtggcttggctcatggtgtcttcctgctgaatagcaatgccatggacgtg
gtcctgcagcccaggccagccctcacctggaggtcaacaggagggatcctggatgtgtat
gtgttcctgggcccagagcccaagagtgtggtgcagcagtaccaggatgtcgtgggatac
cccttcatgccaccgtactggggcctgggcttccacctttgccgctggggttactcctct
accaccatcctccgtcaggtggtagagaacatgaccaaggcacgcttccccctggatgtg
cagtggaatgacctggactacatggatgcccgcagggactttaccttcaacaaggatggc
tttgaggacttgccagcgtttgtgcaagacctccaccagggtggccggcggtacatgatg
attgtggaccccgccatcagcagctcaggccctgctgggagctacaggccgtacgatgag
ggtctgcagaggggcgttttcatcaccaatgagactgggcagccactgattggaaaggtg
tggccaggatccaccgccttccctgacttcaccaaccctgagaccctggactggtggcag
gacatggtgtctgagttccatgcccaggtcccctttgatggcatgtggatcgacatgaac
gaaccatccaacttcataaggggctctgagcagggctgccccaataacaatctggagaac
ccaccctatgtgcctggggtggtgggtgggaccttgcaggcggccaccatctgtgcctcc
agccgccagttcctttccacacactacaacctccacaacttgtatggcctgaccgaagct
atcgcctccaacagggccctggtgaaagctcgggggacacgaccctttgtgatctcccgt
tcaacctttgccagccatggccggtacgctggccactggacgggggatgtgtggagcagc
tgggaacagctttcatactcggtggctgaaatcctgcagtttaacctgctgggtgtgccc
ctggtgggggcagacatctgcggcttcctgggcaacacgtcagaagagctatgtgtgcgc
tggactcaactggggatcttctaccccttcatgcggaatcacaatgacctacatagcatg
cctcaggagccatacaggttcagtgagacggcgcagcaggctatgaggaatgccttcgcc
ctgcgttacgccctactgccctacctctacacactcttccacagagcccacgtcaacggg
gacacagtggcccggcccctcttcctagagttccccgaggatcccagcacctggactgtg
gaccgccagctcttgttggggccggccctacttgtcacccccgtgcttgagcccgggaaa
actgaagagacgggctacttccctgctggcacatggtacaacctgcaaaccgtgccagtg
gaggcctttggcagcctcccacctctgccctcagcagccttcagctctgccatccacagc
aaggggcagtgggtgacactctcgaccccactggacaccatcaatgtgaatctgcgggca
gggtacattgtgcccctgcagggtcctgacctcacaaccacagagtcacgaaaacagccc
atggctctggttgtggccctaacaacaagtggcgaggcccatggggagctgtactgggac
gatggggagagccttggggtgctggagcagggggcctatacacaggtcaccttccaagcc
aagaacaacaccatcacgaatgagttggtacatgtgtccaaagagggggccaacctgcag
ctgaggagtgtgtccgtcgtaggtgtgaccacagcccccacccaggtcttctccaacggt
atccctgtctccaacttcacctacagccctgacagcaagatcctggccatcccagtctcg
ctgctcatgggggagcagtttcgcatcagttggtcctag

DBGET integrated database retrieval system