KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730663
Entry
103730663         CDS       T03372                                 

Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor B-like
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi01524  Platinum drug resistance
ngi04110  Cell cycle
ngi04115  p53 signaling pathway
ngi04218  Cellular senescence
ngi04934  Cushing syndrome
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05206  MicroRNAs in cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05220  Chronic myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103730663
   04115 p53 signaling pathway
    103730663
   04218 Cellular senescence
    103730663
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730663
   05206 MicroRNAs in cancer
    103730663
   05203 Viral carcinogenesis
    103730663
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103730663
   05225 Hepatocellular carcinoma
    103730663
   05214 Glioma
    103730663
   05220 Chronic myeloid leukemia
    103730663
   05218 Melanoma
    103730663
   05219 Bladder cancer
    103730663
   05223 Non-small cell lung cancer
    103730663
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103730663
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103730663
   05163 Human cytomegalovirus infection
    103730663
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103730663
   01522 Endocrine resistance
    103730663
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 103730663
NCBI-ProteinID: XP_008827157
LinkDB
Position
Un
AA seq 134 aa
MESADRLARAAARGREQEVRELLEAGVSPNARNRFGRTPIQVMMMGSARVASLLLLHGAD
PNCADPATLTRPVHDAAREGFLDTLVALHQAGARLDVRDAWGRLPVDLAQEWGHPDVARF
LRTAAGASPGGKPQ
NT seq 405 nt   +upstreamnt  +downstreamnt
atggagtccgccgaccgcctggctcgagcggcggcccggggccgcgagcaggaggtgcgg
gagctgctggaagccggggtgtcgcccaacgcccggaaccggttcgggcgcaccccgatt
caggtcatgatgatgggcagcgcccgcgtagccagcctgctgctgctccatggagcggac
cccaactgcgccgaccccgccaccctcacccggccggtgcacgacgcggcccgggagggc
ttcctggacacgctggtggcgctgcaccaggcgggggcgcggctggatgtgcgtgacgcc
tggggccgcctgccggtggacctggcccaggagtggggccaccccgatgtcgcgcggttc
ctgcgcaccgccgcgggcgcctccccgggcggcaagccccaatag

DBGET integrated database retrieval system