KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730772
Entry
103730772         CDS       T03372                                 

Gene name
Vegfa
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04370  VEGF signaling pathway
ngi04510  Focal adhesion
ngi04926  Relaxin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05219  Bladder cancer
ngi05323  Rheumatoid arthritis
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103730772 (Vegfa)
   04014 Ras signaling pathway
    103730772 (Vegfa)
   04015 Rap1 signaling pathway
    103730772 (Vegfa)
   04370 VEGF signaling pathway
    103730772 (Vegfa)
   04066 HIF-1 signaling pathway
    103730772 (Vegfa)
   04020 Calcium signaling pathway
    103730772 (Vegfa)
   04151 PI3K-Akt signaling pathway
    103730772 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103730772 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103730772 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103730772 (Vegfa)
   05206 MicroRNAs in cancer
    103730772 (Vegfa)
   05205 Proteoglycans in cancer
    103730772 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103730772 (Vegfa)
   05211 Renal cell carcinoma
    103730772 (Vegfa)
   05219 Bladder cancer
    103730772 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103730772 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103730772 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103730772 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103730772 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103730772 (Vegfa)
   05165 Human papillomavirus infection
    103730772 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103730772 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103730772 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103730772 (Vegfa)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103730772 (Vegfa)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103730772 (Vegfa)
SSDB
Motif
Pfam: VEGF_C CXCXC
Other DBs
NCBI-GeneID: 103730772
NCBI-ProteinID: XP_008827276
LinkDB
Position
Un
AA seq 137 aa
MAGALGCPIWVWLAGSLTSVICFLPLQIMRIKPHQSQHIGEMSFLQHNRCECRPKKDRTR
LEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKA
RQLELNERTCRCDKPRR
NT seq 414 nt   +upstreamnt  +downstreamnt
atggcaggagccctggggtgtcccatctgggtatggctggctgggtcactaacctctgtg
atctgcttcctccccctgcagatcatgcgaatcaaacctcaccaaagccagcacatagga
gagatgagcttcctacagcacaacagatgtgaatgcagaccaaagaaagacagaacaagg
ctagaaaaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcc
cggtttaagtcctggagtgttcactgtgagccttgctcagagcggagaaagcatttgttt
gtccaagatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcg
aggcagcttgagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system