KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730795
Entry
103730795         CDS       T03372                                 

Gene name
Srf
Definition
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi05166  Human T-cell leukemia virus 1 infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103730795 (Srf)
   04022 cGMP-PKG signaling pathway
    103730795 (Srf)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103730795 (Srf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103730795 (Srf)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    103730795 (Srf)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 103730795
NCBI-ProteinID: XP_008827312
LinkDB
Position
Un
AA seq 510 aa
MLPSQAGAAAALGRGSALGGSLSRTPTGRPGSGGGGGTRGANGGRVPGNGAGLGAGRLER
EAVAAAASTPAPTAGALYSGSEGDSESGEDEELGAERRGLKRSLSEMELGVVVGGPEASA
AAAGGYGPVSGGVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTL
TGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSA
TGFEEPDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFP
ITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQ
AIQVHQAPQQTSPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYA
PTSGLADGSLTVLNAFSQAPSTMQVSHSQVQEQGGVPQVFLTAPSGTVQIPVSAVQLHQM
AVIGQQAGSSSNLTELQVVNLDATHSTKSE
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgttaccgagccaggctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgagccggaccccgacggggcggccgggcagtggaggcggcggcgggactcgcggg
gcgaacgggggccgggtccccgggaacggcgcggggctcggagcgggccgcctggagcgg
gaggctgtagcggcggcggccagcaccccggcgcccaccgcgggggccctctacagcggc
agcgagggcgactccgagtccggcgaggacgaggagctgggcgccgagcggcgcggcctg
aagcggagcttgagcgagatggagctcggtgtggtggtcggtgggcccgaggcgtcggcg
gcggctgccgggggctacgggccggtgagcggcggggtgagcggagccaagccgggtaag
aagacccggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgttac
acgaccttcagcaagaggaagaccggcatcatgaagaaggcctatgaactgtccacgctg
acagggacacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgcc
acccgcaaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgc
ctcaactcgccagactctccaccccgttcagaccccaccacagaccagagaatgagtgcc
actggctttgaagagccagatctcacctaccaggtgtcggagtctgacagcagtggggag
accaaggacacactgaagccagcgttcacagtcaccaacctgccaggtaccacctccacc
atccaaacagcacccagcacctctaccaccatgcaagtcagcagcggcccctccttcccc
atcaccaactacctggcaccagtgtctgctagtgtcagccccagcgctgtcagcagtgcc
aacgggactgtgctgaagagtacgggcagtggccctgtctcctccgggggccttatgcag
ctgcctaccagcttcaccctcatgcctggtggggcagtggcccagcaggtccccgtgcag
gccattcaggtgcaccaagccccacagcaaacgtctccctctcgtgacagcagcacagac
ctcacgcagacctcctccagcgggacagtgacgttgcccgccaccatcatgacgtcgtca
gtacccacaactgtgggtggccacatgatgtaccctagtccccatgcagtgatgtatgcc
cccacctcgggcctggctgatggcagcctcaccgtgctcaatgccttctcccaggcacca
tccaccatgcaggtgtcccacagccaggtccaggagcaaggtggtgtcccccaggtgttc
ctgacagcaccatctgggacggtgcagatccctgtttctgcagttcagcttcaccagatg
gctgtgatagggcagcaagctgggagcagcagcaacctcaccgagctacaggtggtgaac
ctggatgccacccacagcaccaagagtgaatga

DBGET integrated database retrieval system