KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730826Help
Entry
103730826         CDS       T03372                                 

Gene name
Hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04371  Apelin signaling pathway
ngi05034  Alcoholism
ngi05165  Human papillomavirus infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103730826 (Hdac4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    103730826 (Hdac4)
  09165 Substance dependence
   05034 Alcoholism
    103730826 (Hdac4)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    103730826 (Hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103730826 (Hdac4)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103730826 (Hdac4)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103730826 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103730826
NCBI-ProteinID: XP_008827347
LinkDB All DBs
Position
Un
AA seq 1082 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMSSTVDVAAALPLQVAPAAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAL
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPMVTALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSVPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPSAGAAGQQDAERLALPALQQRISLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLE
QPPTQTPLVTGLGALPLHTQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLV
IQQQHQQFLEKHKQQFQQQQLHLSKMISKPSEPPRQPESHPEETEEELREHQALLDEPYL
DRLPAQKEPSLTGVQVKQEPIESEEEEVEPTREAEPGQRPPTEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLM
LKHQCACGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLL
YGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELV
FKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVH
HGNGTQQAFYSDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLEPPM
GDTEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMG
LAGGRIVLALEGGHDLTAICDASEACVSALLGNELEPLPDKVLQQRPNANAVRSMEKVMD
IHSKYWRCLQRLSSTAGHSLVEAQKCETEEAETVTAMASLSVGVKPAEKRPEEEPMEEEP
PL
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgagtgaaccacatgtccagcacagtggacgtggcagcggcactgcctctg
caagtggcccctgcagcagtgcccatggacctgcgcctagaccaccagttctcgctgccc
ttggaacctgcactgcgagagcagcagctgcagcaggagctcctggcactgaaacagaag
cagcagatccagcggcagatcctcatcgccgagttccaacggcagcacgagcagctgtcc
cgacagcatgaggcgcagctacatgagcacattaagcagcagcaggaaatgctggccttg
aagcaccagcaggagctgctggagcaccagcggaagctggagcggcaccggcaggagcag
gagctggagaagcagcaccgagagcagaagttgcagcagctcaagaacaaggagaagggc
aaagagagtgccgtggccagcacagaggtgaaaatgaagctgcaggagttcgtactcaac
aagaaaaaggcactggcccaccggaacctgaaccattgcatttccagcgacccccgctac
tggtatgggaagacacagcacagctccctcgaccagagttctccgccccagagtggagtg
tcggcctcctacaaccacccagtcctgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttccgaacccaacctgaaattacggtccaggcttaagcagaaagtggct
gagagacggagtagccccctgttgcgcaggaaagatggccccatggtcactgctctaaaa
aagcgtcccctggatgtcacagactcagcgtgcagcagtgcccctggctccggtcccagc
tctcccaacagcagctctggcaacgtcagcactgaaaacggcattgcacccaccgtaccc
agtgttccagccgagaccagcttggcgcacagacttgtgactcgagaaggctcagtcgcc
ccgctccctctctacacatcgccttccttgcccaacatcaccttgggacttcctgccact
ggcccttctgctggtgcagcaggccagcaggatgccgagaggctagctctcccggctctc
cagcagcgcatctccttgtttcccggcactcacctaaccccgtacctgagcacctcaccc
ctggagcgggatggcggggcagctcacagtccccttctgcagcacatggtcctgctggaa
cagccacccactcagacaccccttgtcacaggcctgggggcactgcccctccacacgcag
tccctggttggtgcagacagggtgtccccatctatccacaagctgcggcagcaccgcccc
ctggggcgtacacagtcagcaccgttgccgcagaacgcgcaggccctgcagcacctggtg
atccagcagcagcaccagcagttcctggagaagcacaagcagcagttccagcagcagcag
ctgcacctcagcaagatgatctctaagcccagtgaaccaccccggcagcccgagagccac
cctgaggagacagaggaggagctccgagagcaccaggccctgctcgatgagccctatcta
gaccgactcccagcacagaaggagccctcgctgaccggtgtgcaggtgaaacaggagccc
attgaaagtgaggaggaggaggtggagcccactcgggaggcagagcctggccagcgtccg
cccactgagcaggagctgctcttcagacagcaagctctcctgctggagcaacaacggatc
caccagctaaggaactaccaggcatccatggaggccgctggcattcctgtgtcgtttggc
agccacagacctctgtcccgggcacagtcctccccagcctccgctaccttccccatgtca
gtccaggagccccccaccaagccaaggttcaccacaggccttgtgtacgacacgctgatg
ctgaaacaccagtgcgcctgcgggaataccaacagccatcctgagcatgctgggaggatc
cagagcatctggtcccgcctgcaggagactggcctccgtggcaagtgtgagtgcatccgt
ggacggaaggccacactagaggaactgcagacggtgcactcggaggcccacacactactc
tatggcacaaacccgctcaacaggcagaaactggacagtaagaaacttctaggctcactg
acctccatgtttgtgaggcttccttgtggtggtgtcggagtggacagtgacaccatctgg
aatgaggtacactcgtcgggagcagcccgcctggctgtgggctgtgtggtggagctggtc
ttcaaagtagccacgggggagctgaagaatggctttgctgtggttcgccctccaggacac
catgccgaggagagcacacccatggggttctgctacttcaactctgtggcagttgcagcc
aagcttctccagcagaggctgaacgtgagcaagatcctcattgtagactgggatgtccac
catgggaacgggactcagcaggccttctacagtgaccccaatgttctctacatgtccctg
caccgctatgacgatgggaacttcttcccaggcagtggcgcaccagatgaggtgggcaca
ggtccaggcgtaggtttcaacgtcaacatggctttcacaggtggcctcgaaccccccatg
ggagacacagagtacttggcagccttcagaaccgtggtcatgccgatcgcaaacgagttt
gccccagatgtggtactggtgtcttcaggctttgatgctgtggaaggccaccccacacct
cttggagggtacaatctctctgccaaatgttttgggtacttgacaaagcaactgatgggc
ctggctggtggccggattgtgctagcccttgagggaggccacgacctgacagctatctgc
gatgcctctgaagcatgtgtttctgctctgctgggaaatgagctggagcctctgccagac
aaggttctacagcagagacccaacgccaatgcggtccggtccatggaaaaagtgatggac
atccacagcaagtactggcggtgcctgcagcgcctgtcctccaccgctgggcactctctg
gttgaggcgcagaagtgcgagactgaagaagctgagacagtcacagccatggcctcgctg
tccgtgggcgtgaagcctgctgagaagaggcctgaggaggagcccatggaggaggagcca
ccactgtag

DBGET integrated database retrieval system