KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730826Help
Entry
103730826         CDS       T03372                                 

Gene name
Hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04371  Apelin signaling pathway
ngi05034  Alcoholism
ngi05165  Human papillomavirus infection
ngi05169  Epstein-Barr virus infection
ngi05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103730826 (Hdac4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103730826 (Hdac4)
  09164 Substance dependence
   05034 Alcoholism
    103730826 (Hdac4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    103730826 (Hdac4)
   05165 Human papillomavirus infection
    103730826 (Hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103730826 (Hdac4)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103730826 (Hdac4)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103730826 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 103730826
NCBI-ProteinID: XP_008827347
LinkDB All DBs
Position
Un
AA seq 1082 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMSSTVDVAAALPLQVAPAAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAL
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPMVTALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSVPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPSAGAAGQQDAERLALPALQQRISLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLE
QPPTQTPLVTGLGALPLHTQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLV
IQQQHQQFLEKHKQQFQQQQLHLSKMISKPSEPPRQPESHPEETEEELREHQALLDEPYL
DRLPAQKEPSLTGVQVKQEPIESEEEEVEPTREAEPGQRPPTEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLM
LKHQCACGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLL
YGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELV
FKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLNVSKILIVDWDVH
HGNGTQQAFYSDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLEPPM
GDTEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMG
LAGGRIVLALEGGHDLTAICDASEACVSALLGNELEPLPDKVLQQRPNANAVRSMEKVMD
IHSKYWRCLQRLSSTAGHSLVEAQKCETEEAETVTAMASLSVGVKPAEKRPEEEPMEEEP
PL
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgagtgaaccacatgtccagcacagtggacgtggcagcggcactgcctctg
caagtggcccctgcagcagtgcccatggacctgcgcctagaccaccagttctcgctgccc
ttggaacctgcactgcgagagcagcagctgcagcaggagctcctggcactgaaacagaag
cagcagatccagcggcagatcctcatcgccgagttccaacggcagcacgagcagctgtcc
cgacagcatgaggcgcagctacatgagcacattaagcagcagcaggaaatgctggccttg
aagcaccagcaggagctgctggagcaccagcggaagctggagcggcaccggcaggagcag
gagctggagaagcagcaccgagagcagaagttgcagcagctcaagaacaaggagaagggc
aaagagagtgccgtggccagcacagaggtgaaaatgaagctgcaggagttcgtactcaac
aagaaaaaggcactggcccaccggaacctgaaccattgcatttccagcgacccccgctac
tggtatgggaagacacagcacagctccctcgaccagagttctccgccccagagtggagtg
tcggcctcctacaaccacccagtcctgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttccgaacccaacctgaaattacggtccaggcttaagcagaaagtggct
gagagacggagtagccccctgttgcgcaggaaagatggccccatggtcactgctctaaaa
aagcgtcccctggatgtcacagactcagcgtgcagcagtgcccctggctccggtcccagc
tctcccaacagcagctctggcaacgtcagcactgaaaacggcattgcacccaccgtaccc
agtgttccagccgagaccagcttggcgcacagacttgtgactcgagaaggctcagtcgcc
ccgctccctctctacacatcgccttccttgcccaacatcaccttgggacttcctgccact
ggcccttctgctggtgcagcaggccagcaggatgccgagaggctagctctcccggctctc
cagcagcgcatctccttgtttcccggcactcacctaaccccgtacctgagcacctcaccc
ctggagcgggatggcggggcagctcacagtccccttctgcagcacatggtcctgctggaa
cagccacccactcagacaccccttgtcacaggcctgggggcactgcccctccacacgcag
tccctggttggtgcagacagggtgtccccatctatccacaagctgcggcagcaccgcccc
ctggggcgtacacagtcagcaccgttgccgcagaacgcgcaggccctgcagcacctggtg
atccagcagcagcaccagcagttcctggagaagcacaagcagcagttccagcagcagcag
ctgcacctcagcaagatgatctctaagcccagtgaaccaccccggcagcccgagagccac
cctgaggagacagaggaggagctccgagagcaccaggccctgctcgatgagccctatcta
gaccgactcccagcacagaaggagccctcgctgaccggtgtgcaggtgaaacaggagccc
attgaaagtgaggaggaggaggtggagcccactcgggaggcagagcctggccagcgtccg
cccactgagcaggagctgctcttcagacagcaagctctcctgctggagcaacaacggatc
caccagctaaggaactaccaggcatccatggaggccgctggcattcctgtgtcgtttggc
agccacagacctctgtcccgggcacagtcctccccagcctccgctaccttccccatgtca
gtccaggagccccccaccaagccaaggttcaccacaggccttgtgtacgacacgctgatg
ctgaaacaccagtgcgcctgcgggaataccaacagccatcctgagcatgctgggaggatc
cagagcatctggtcccgcctgcaggagactggcctccgtggcaagtgtgagtgcatccgt
ggacggaaggccacactagaggaactgcagacggtgcactcggaggcccacacactactc
tatggcacaaacccgctcaacaggcagaaactggacagtaagaaacttctaggctcactg
acctccatgtttgtgaggcttccttgtggtggtgtcggagtggacagtgacaccatctgg
aatgaggtacactcgtcgggagcagcccgcctggctgtgggctgtgtggtggagctggtc
ttcaaagtagccacgggggagctgaagaatggctttgctgtggttcgccctccaggacac
catgccgaggagagcacacccatggggttctgctacttcaactctgtggcagttgcagcc
aagcttctccagcagaggctgaacgtgagcaagatcctcattgtagactgggatgtccac
catgggaacgggactcagcaggccttctacagtgaccccaatgttctctacatgtccctg
caccgctatgacgatgggaacttcttcccaggcagtggcgcaccagatgaggtgggcaca
ggtccaggcgtaggtttcaacgtcaacatggctttcacaggtggcctcgaaccccccatg
ggagacacagagtacttggcagccttcagaaccgtggtcatgccgatcgcaaacgagttt
gccccagatgtggtactggtgtcttcaggctttgatgctgtggaaggccaccccacacct
cttggagggtacaatctctctgccaaatgttttgggtacttgacaaagcaactgatgggc
ctggctggtggccggattgtgctagcccttgagggaggccacgacctgacagctatctgc
gatgcctctgaagcatgtgtttctgctctgctgggaaatgagctggagcctctgccagac
aaggttctacagcagagacccaacgccaatgcggtccggtccatggaaaaagtgatggac
atccacagcaagtactggcggtgcctgcagcgcctgtcctccaccgctgggcactctctg
gttgaggcgcagaagtgcgagactgaagaagctgagacagtcacagccatggcctcgctg
tccgtgggcgtgaagcctgctgagaagaggcctgaggaggagcccatggaggaggagcca
ccactgtag

DBGET integrated database retrieval system