KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731080
Entry
103731080         CDS       T03372                                 

Gene name
Bcl2l1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01524  Platinum drug resistance
ngi04014  Ras signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04115  p53 signaling pathway
ngi04137  Mitophagy - animal
ngi04140  Autophagy - animal
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04215  Apoptosis - multiple species
ngi04621  NOD-like receptor signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi05012  Parkinson disease
ngi05014  Amyotrophic lateral sclerosis
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05145  Toxoplasmosis
ngi05162  Measles
ngi05166  Human T-cell leukemia virus 1 infection
ngi05168  Herpes simplex virus 1 infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05212  Pancreatic cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103731080 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    103731080 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    103731080 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    103731080 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103731080 (Bcl2l1)
   04137 Mitophagy - animal
    103731080 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    103731080 (Bcl2l1)
   04215 Apoptosis - multiple species
    103731080 (Bcl2l1)
   04115 p53 signaling pathway
    103731080 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103731080 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731080 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    103731080 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103731080 (Bcl2l1)
   05225 Hepatocellular carcinoma
    103731080 (Bcl2l1)
   05220 Chronic myeloid leukemia
    103731080 (Bcl2l1)
   05222 Small cell lung cancer
    103731080 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103731080 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    103731080 (Bcl2l1)
   05162 Measles
    103731080 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    103731080 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103731080 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103731080 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    103731080 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    103731080 (Bcl2l1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103731080 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103731080 (Bcl2l1)
   01524 Platinum drug resistance
    103731080 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ngi01009]
    103731080 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103731080 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ngi02000]
    103731080 (Bcl2l1)
Protein phosphatases and associated proteins [BR:ngi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103731080 (Bcl2l1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103731080 (Bcl2l1)
Transporters [BR:ngi02000]
 Other transporters
  Pores ion channels [TC:1]
   103731080 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103731080
NCBI-ProteinID: XP_008827614
LinkDB
Position
Un
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLV
DSPAVNGATGHSSSLDARELIPMVAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcgtacaagctttcccagaaa
ggatacagctggagtcagttcagtgatgtcgaagagaacaggactgaggccccagaagga
actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcatctggtg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggagctg
atccccatggttgcagtgaagcaagcgctaagagaggctggggatgagtttgaactgcgg
taccggcgggcattcagtgacctaacatcccagcttcatataaccccggggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgagatggggtaaactggggtcgcatt
gtggcctttttctcctttggcggtgcactgtgtgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaagttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaacgcagca
gctgagagtcggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttcttctgggttcactctttagccggaagtga

DBGET integrated database retrieval system