KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731111
Entry
103731111         CDS       T03372                                 

Gene name
Csf3
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04151  PI3K-Akt signaling pathway
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04657  IL-17 signaling pathway
ngi05144  Malaria
ngi05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103731111 (Csf3)
   04151 PI3K-Akt signaling pathway
    103731111 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103731111 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103731111 (Csf3)
   04657 IL-17 signaling pathway
    103731111 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103731111 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    103731111 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103731111 (Csf3)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103731111 (Csf3)
SSDB
Motif
Pfam: GCSF IL11 IL6 Sigma54_AID
Other DBs
NCBI-GeneID: 103731111
NCBI-ProteinID: XP_008827638
LinkDB
Position
Un
AA seq 216 aa
MAQPSAQSHMKLITLQLLLWHSILWMVQTIPLVSASSVPPPLPLPKSFLLKSLEQVRKIQ
AKDEVLLEQLVSKRRQRCATYKLCHPEELALLGHSLGIPQAPLSSCSSQALQLRSCLRQL
HSGLLLYKGLLQALAGISPELALTLDMLQLDVTNFATTIWQQMENLGVAPAVQPTQNTMP
TFASAFQRRAGGVLATSHLQDFLGMAYRALRHFAQP
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcacaaccttctgcccagagccacatgaagctgatcaccctgcagctgctgctgtgg
cacagtattctctggatggtgcagaccattcccctggtctctgccagttctgtgccacca
cccctgcccctacccaagagcttcctactcaagtccttagaacaagtgaggaagatccag
gccaaagacgaggtgctgctggagcagctggtgagtaagaggcggcagaggtgtgccacc
tacaagctgtgccaccctgaggagctggcactgcttggtcactccctgggcatcccacag
gctcccctgagcagctgttccagccaggccctgcagctgaggagctgcctgagacaactc
cacagtggactccttctctacaagggcctcctgcaggctctggcagggatttcccctgag
ctagccctcaccttggacatgctgcagctggatgttaccaactttgccaccaccatctgg
cagcagatggaaaacttaggggtggcccctgccgtgcagcctacccaaaacaccatgcca
acctttgcttctgctttccagcgccgggcaggaggtgtcctggccacctcccacctgcag
gacttcctggggatggcctaccgtgctctgcgtcacttcgcccagccctga

DBGET integrated database retrieval system