KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731177Help
Entry
103731177         CDS       T03372                                 

Gene name
Gabrq
Definition
(RefSeq) gamma-aminobutyric acid type A receptor theta subunit
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04080  Neuroactive ligand-receptor interaction
ngi04723  Retrograde endocannabinoid signaling
ngi04727  GABAergic synapse
ngi05032  Morphine addiction
ngi05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103731177 (Gabrq)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103731177 (Gabrq)
   04723 Retrograde endocannabinoid signaling
    103731177 (Gabrq)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    103731177 (Gabrq)
   05033 Nicotine addiction
    103731177 (Gabrq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103731177 (Gabrq)
Ion channels [BR:ngi04040]
 Ligand-gated channels
  GABA-A
   103731177 (Gabrq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 103731177
NCBI-ProteinID: XP_008827723
LinkDB All DBs
Position
Un
AA seq 639 aa AA seqDB search
MGIRGMLRAAALLLLIRTWLAESNGPSPTPKFHFEFSSNMPKVVVDLFNCKNCANEAVVQ
KILDRVLSTYDVRLRPNFGGAPVPVSVSIYVSSIEQISEINMDYTITLFLHQTWKDTRLA
YNETNLNLTLDYQMYKKLWVPDCYFVNSKDAFVHDVTVENRVFQLQPDGTVRYGIRLTTT
AACSLDLQKFPMDKQACKLEVESYGYTVEDIMLSWEDSENAIHMTDELQIPQYTFLGQTI
TSKEVYFYTGSYMRLIVKFQVQREVRSYLVQVYWPTVLTTILSWISFWMNYGSSAARVTI
GLTSILVLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFLSLLEYVYINYLFFSQGPRR
NRRRHRRPRRVVARFRYEEVVVQNVQDGLINVEEIVEDRAGPLPNSPMQARLASLESLDS
LASSSEPAQLATSESLSPVSSHSGQAQLATGESLSNLPSTSQQSLQDCTIHFHGFHTNDS
IIPIKIHHCAEAHGDDDAEDSLSSDESHGHGYGPSGRSMPPHGQRCVQEASWDLDKIESL
QDDISVKSSWLGLDEQCKGDADSVWSLTDEEIMACDQEKDSSSESEENCPPSPGCSFNEG
FSFRLFKPDRVPKVDRWSRFLFPLSFGLFNVVYWLYHIY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgcggcatgctgcgggcagccgcgctcctgctgctcatcaggacttggcta
gcagagagcaacggtcccagtcccaccccgaaattccacttcgagttctcctccaatatg
cccaaagtcgtcgtggatctcttcaactgcaaaaattgtgcaaatgaagctgtagttcag
aagattttggacagagtgctgtcgacatatgatgtccgactgagaccaaattttggaggt
gctcctgtgcctgtgtcggtatctatctatgtgtccagtattgaacaaatttcagaaata
aatatggactatacaatcaccttgtttctgcatcagacctggaaggatacacgtttagca
tacaatgagaccaacctgaacctgaccctggactatcagatgtacaagaagttatgggtc
cccgactgctactttgtgaatagcaaagatgcttttgttcatgatgtaactgtagagaat
cgtgtgtttcagcttcagccagatgggacagtgcgatacggcatccgacttaccacaaca
gcagcctgttccctggatctgcaaaaattccctatggacaagcaggcctgcaagctggag
gtggagagctatggttacacagtagaagacatcatgttatcctgggaagacagtgagaat
gccatccacatgactgatgagctgcagatccctcagtataccttcctggggcagacaatt
actagcaaggaggtgtacttctatacaggttcctacatgcgcctaatagtgaagttccag
gtccagagggaagtccgcagttacctggtgcaggtctactggcccacagtcctcaccacc
attctctcctggatatcattttggatgaactatggttcctctgcagccagagtgacaatt
ggcttaacttcaatcctcgtcctgaccaccatcgactcacatatgcgggataaacttccc
catatttcctgcatcaaggccattgacatctatatccttgtgtgcttgttcttcgtgttc
ctgtccctgctggagtatgtctacatcaactaccttttcttcagccaaggacctcggcgc
aatcgccggcgacacaggagacccagaagagttgttgcccgcttccgctatgaagaagtg
gtcgtgcaaaacgtgcaggatggcctgattaatgtggaagagatagtagaagacagagct
ggccctcttcccaacagccccatgcaagcccgtctggcaagcctggaaagccttgactct
ttggcgtcctcctcagagccagcccagctggccacctcggaaagcctgagcccagtctct
tcccactcaggccaggcccagctggccactggagaaagcctgagcaatctcccctccact
tctcagcagagcctgcaggactgtaccattcacttccatggctttcacactaacgacagt
attatccctatcaaaatccaccactgtgctgaggcccatggtgatgacgatgccgaagac
agcctgagttcagatgagagccatggtcatggctatggccccagtggaagaagcatgccg
ccccatggccagaggtgtgtgcaggaagcaagctgggaccttgataagattgagagctta
caggatgacatcagtgtcaagagcagctggcttggccttgatgaacaatgcaagggggat
gctgacagtgtctggagccttactgatgaggagatcatggcctgtgaccaagagaaggac
agtagctcagagtctgaggagaattgccccccgagccctgggtgctccttcaacgaaggg
ttctctttcaggctctttaaacctgaccgggttcctaaggttgacaggtggtcccgcttc
ctcttccctctttcctttgggctgttcaacgtggtttactggctttaccacatctattag

DBGET integrated database retrieval system