KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731232
Entry
103731232         CDS       T03372                                 

Gene name
Ikbkg
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01523  Antifolate resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04210  Apoptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04668  TNF signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi05132  Salmonella infection
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05212  Pancreatic cancer
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05222  Small cell lung cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05340  Primary immunodeficiency
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103731232 (Ikbkg)
   04014 Ras signaling pathway
    103731232 (Ikbkg)
   04064 NF-kappa B signaling pathway
    103731232 (Ikbkg)
   04668 TNF signaling pathway
    103731232 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    103731232 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103731232 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103731232 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    103731232 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    103731232 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    103731232 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    103731232 (Ikbkg)
   04660 T cell receptor signaling pathway
    103731232 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    103731232 (Ikbkg)
   04659 Th17 cell differentiation
    103731232 (Ikbkg)
   04657 IL-17 signaling pathway
    103731232 (Ikbkg)
   04662 B cell receptor signaling pathway
    103731232 (Ikbkg)
   04062 Chemokine signaling pathway
    103731232 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103731232 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103731232 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731232 (Ikbkg)
   05203 Viral carcinogenesis
    103731232 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103731232 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103731232 (Ikbkg)
   05221 Acute myeloid leukemia
    103731232 (Ikbkg)
   05220 Chronic myeloid leukemia
    103731232 (Ikbkg)
   05215 Prostate cancer
    103731232 (Ikbkg)
   05222 Small cell lung cancer
    103731232 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    103731232 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103731232 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103731232 (Ikbkg)
   05135 Yersinia infection
    103731232 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103731232 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    103731232 (Ikbkg)
   05162 Measles
    103731232 (Ikbkg)
   05164 Influenza A
    103731232 (Ikbkg)
   05161 Hepatitis B
    103731232 (Ikbkg)
   05160 Hepatitis C
    103731232 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    103731232 (Ikbkg)
   05163 Human cytomegalovirus infection
    103731232 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103731232 (Ikbkg)
   05169 Epstein-Barr virus infection
    103731232 (Ikbkg)
   05165 Human papillomavirus infection
    103731232 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103731232 (Ikbkg)
   05142 Chagas disease
    103731232 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103731232 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103731232 (Ikbkg)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103731232 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Filament DpnI_C UPF0242
Other DBs
NCBI-GeneID: 103731232
NCBI-ProteinID: XP_008827829
LinkDB
Position
Un
AA seq 418 aa
MSRHLWKNQLSEMVQPSSGPAGDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVEKLSREKLELRIQKEQ
ALKDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRVRAVNEQ
VRQLESEQEVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD
YDNHIKNSMASGERKRGMQLEDVRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLVEKKELLQEQLEQLQREFSKLKAGCHESARIEDMRKRH
VETSQPPLPTVPAHSFHPPIPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagaatcagctgagtgagatggtgcagcccagcagtggtcca
gcaggggaccaggacatgctgggtgaagagtcttctctagggaagccagccatgctgcat
ctgccttcagagcagggcacccctgagaccctccaacgatgtctggaagagaatcaggag
cttcgagatgccatccggcagagcaatcagatgctgcgagagcgctgcgaggagctgctg
catttccaggtcagccaacgtgaggagaaggagtttctcatgtgcaaattccaagaagcc
aggaagctggtagagaagctgagccgggagaagcttgaacttcggatacagaaggagcag
gccctaaaggatttggagcacctgaagaaatgccaacagcagatggctgaggacaaggcc
tcagtgaaagcccaggtgacatcattgctaggggagctccaggagagccagagtcgcttg
gaggctgccaccaaggaacgacaggctttggagggcagggtgcgagcagtcaacgagcag
gtcaggcagctggagagtgaacaggaggtgttgcagcagcagcacagtgtgcaggtggac
cagctgcgcatgcagaaccagagtgtggaggctgccctgcgcatggaacgccaggctgcc
tcagaggagaagcggaagctggctcagttgcaggtggcctatcaccagctcttccaagac
tatgacaaccacatcaagaatagcatggcaagcggagagcgcaagcgaggcatgcagctg
gaggatgtcaggcagcagctacagcaagccgaggaggcgctggtggccaagcaggaattg
attgacaagttgaaagaggaggctgagcagcacaaaatagtgatggagactgtgccagtt
ctgaaggcccaggcggatatctataaggctgacttccaggctgagaggcaggctcgagaa
aagctggtggagaagaaggaacttttgcaggagcagctggaacagctgcagcgcgagttc
agcaagctgaaggccggctgccatgaatcagccaggattgaggatatgaggaagcggcat
gtagagacttcccagccccctctacccactgttccagctcactcctttcatccacccatc
cccaaccagaggagaagccctcctgaggaaccacctgacttctgttgtcccaagtgccag
tatcaagctcctgatatggacactctacagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system