KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731375
Entry
103731375         CDS       T03372                                 

Gene name
Cacna1e
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103731375 (Cacna1e)
   04020 Calcium signaling pathway
    103731375 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103731375 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103731375 (Cacna1e)
Ion channels [BR:ngi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103731375 (Cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 103731375
NCBI-ProteinID: XP_008827968
LinkDB
Position
Un
AA seq 2398 aa
MLPASPRSTVAGFDNFFPVQEGEGPGWEGSTALEAGSSPFLPVSPEVMKRRRGGLIEQRD
IIKAHEAHKMQSTPQARRKEWEMARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAA
AYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILA
TIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLR
NGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKA
MVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGY
ECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIII
GSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAE
ENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASY
FRHKERLLRISIRHMVKSQVFYWIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLG
LFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLL
RIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPS
ANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNV
FLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMS
MWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPL
NPLNAHPSLYRRPRPIEGLALGLGLEKCEEERISRGGSLKGTTGALTSALDNQRSPLSLG
KREPPWLARSCHGNCDPTQQEAGGGETVVTFEDRTRHRQSQRRSRHRRVRTEGKESASAS
RSRSASQERSLDEGVSTEGEKEHETRGSHGSKEPTIHEEGRAQDLRRTNSLMVPRGSGLA
GALDEAEETPLVPPQPEPEVGKDAVLTEQEPEGSSEQALLGDVQLDVGRGISQSEPDLSC
ITANADKPTTESTSVTVAIPDVDPLMDSTVVHISNKTDGEASPLKEADIKEEEEEGEKKK
QKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDP
VLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALV
AFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIV
YKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHY
DNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFV
NIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFV
VSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFL
NYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRI
LLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLML
LFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQTENERCGTDLAYVYFVSFIFFCSFLML
NLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPL
GLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSEL
QKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKN
APMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPA
DDGQFQEQQSLEPEVSELKSVQSSNHGIYLPSDTQEHAGSGRASSMPRLTMDPQVVTDPS
SMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDT
HRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSESRSQTPNRQGT
GSLSESSIPSISDTSTPRRSHRQLPPVPPKPRPLLSYSSLMRHAGSISPPPNGSEGGSPL
ASQALESNSACLTESSNSLHPQQGQHSSPQHYISEPYLALHEDSHTSDCGEEETLTFEAA
VATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 7197 nt   +upstreamnt  +downstreamnt
atgctgcctgcctcaccccgctccacagtggccggcttcgacaacttcttcccggtgcag
gagggcgagggcccaggttgggagggcagcacagcgctggaggcaggctcgagccccttc
ctccccgtgagccccgaggtaatgaagcggaggcgcgggggcctcatcgagcagagggac
atcatcaaggcccacgaggcacacaagatgcaaagcaccccgcaggcccggcgcaaggag
tgggagatggctcgcttcggggaggcagtggtcgtcggcaggccggggtcaggcgatgga
gactcggaccagagcaggaaccgacaaggaacccctgtacccgcctctgggccggcagct
gcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattccc
gtccggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaagataacatt
gtcaggaaatatgccaagaagctcatcgattggccgccatttgagtacatgatcctggct
accatcattgccaactgcatcgtcttggctctggagcagcatcttcctgaggatgacaag
accccgatgtcccgaagactggagaagacagaaccatatttcattgggatcttctgcttt
gaagctgggatcaaaattgtggccctagggttcatcttccataagggttcatacctccgc
aatggctggaatgtcatggactttattgtggtcctcagtggcatcctggccactgcggga
acccacttcaatacccatgtggacttgcggacactccgggctgtgcgtgtcctgaggccc
ttaaagcttgtgtcaggaatacctagcttgcagatcgtgttgaagtccatcatgaaggcc
atggtgcctcttctgcagattggccttctgcttttctttgccatcctcatgtttgccatc
attggcttagagttctacagtgggaagttacatcgagcatgcttcatgaacaattcaggc
atcctagaaggatttgatcctccgcacccatgtggtgtgcagggctgcccagctggttac
gaatgtaaagactggatcggtcccaatgatggaatcacccagtttgataacatccttttt
gctgtgctgactgtcttccaatgcatcaccatggaagggtggaccactgtgctgtacaat
accaatgatgccttaggagccacctggaattggctgtacttcatccccctcatcatcatt
ggttccttctttgttctcaaccttgtcctgggagtgctttcaggggaatttgccaaagag
agagagagagtggagaatcgaagagcattcatgaagctgcggcgccagcagcagattgag
cgcgaactgaatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaa
gaaaataagaatgctggaacatcagccttggaagtgcttcgaagggcaaccatcaaaagg
agccggacggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttct
gtgggcacaccgcttgcccgagccagtatcaagagcacaaaagtagatggagcctcctat
ttccggcacaaggaacggcttctgcgcatctctatccgccacatggtcaaatcccaggtg
ttttactggatcgtcctgagtgttgtggctctcaacactgcctgtgtggccattgttcat
cacaaccagccccagtggctcactcacctcctttactatgcagaatttttgtttctggga
ctcttcctgttggagatgtccctgaagatgtatggcatggggccacgcctttattttcac
tcttcattcaactgctttgattttggggtcacagtgggcagcatctttgaggtagtctgg
gcaatcttcagacctggtacatcttttggaatcagtgtcttacgtgcgctccggcttcta
agaatatttaaaataaccaagtattgggcatccctccggaatttggttgtctccttgatg
agctccatgaagtccatcatcagcttgctgttcctcctcttcctcttcattgttgtgttt
gctcttctaggaatgcagctgtttggaggcaggtttaacttcaatgatgggactccttca
gcaaattttgataccttccctgcagctatcatgactgtgttccagatcctgacaggggag
gactggaatgaggtgatgtacaacgggatccgctcccagggtggagtcagctcaggcatg
tggtctgccatctacttcattgtgctcaccttatttggaaactacacactactgaatgta
ttcttggccatcgctgtggacaatctggccaatgcccaggaactgaccaaggatgaacag
gaagaagaagaagccttcaaccagaaacatgcactacagaaggccaaggaggtcagcccg
atgtctgcacccaacatgccttctattgaaagagacagaaggagaagacaccacatgtcg
atgtgggagccgcgcagcagccacctgagggagaggagacgaaggcatcacatgtcggtg
tgggagcagcgcaccagccaactgaggaggcatatgcaaatgtctagccaggaggccctc
aacaaagaagaggccccaccgatgaaccccctcaatcccctcaacccactgagccccctc
aacccactcaatgctcaccccagcctctaccggagacccaggcccattgagggcctagcc
ctaggtttgggcctggagaagtgtgaagaggaacgcatcagccgtgggggctcgctcaag
gggactacaggggccttgaccagtgccctggacaaccagaggagccccttgtccttgggc
aaacgggagccaccatggctagccaggtcctgtcatgggaactgtgacccaacccagcag
gaagcggggggaggagagactgtggtgactttcgaggaccggaccagacacaggcagagc
cagcggcgcagccggcaccgtcgagtcaggactgagggcaaagagtctgcatcagcctcc
cggagcagatctgccagccaggagcggagtctggatgaaggggtgtctactgagggggaa
aaggagcatgaaaccaggggcagccatgggagcaaggaaccaaccatccatgaagaggga
agagcccaggacttaaggaggaccaacagtctgatggttcctagaggttctggactggca
ggagcccttgatgaggcagaagaaacacctctagtcccacctcaacctgaaccagaagtg
ggaaaggatgcagtgctgacagagcaggagccagaaggcagcagtgagcaggccctgctt
ggggatgtacagctggatgtaggccggggtatcagccagagtgagcctgatctgtcctgc
atcacagccaacgcagacaagcccaccactgagagtaccagcgtcaccgttgccatccct
gatgtggaccccttgatggactcaacagtggtgcacattagcaacaaaactgatggagaa
gccagtcccttgaaggaggcagatatcaaagaggaggaagaagagggagagaagaagaaa
cagaagaaggaaaagcgagaaacgggcaaagccatggtgccccacagctctatgttcatc
ttcagtaccaccaacccgatccgcagggcctgccactacattgtgaacctgcgctacttc
gagatgtgcatcctcctggtgatcgcagccagcagcattgccctggcagctgaggaccct
gtcttgaccaactcagaacgcaacaaagtcctgaggtattttgactatgttttcaccgga
gtgttcacctttgagatggttataaagatgatagaccaaggcttgatcctgcaagatgga
tcctacttccgagacctctggaacattctggactttgtggtggtggttggtgcattggta
gcctttgctctggcgaacgctttgggaaccaacaaagggcgggacatcaagactatcaag
tctctgagagtgctccgagttctgcggccactgaagaccatcaagcgcttgcccaagctc
aaggctgtgtttgactgtgtggtgacctccttgaagaatgtcttcaacatcctcattgtc
tacaagctcttcatgttcatctttgcggtcattgctgtccagctcttcaagggaaagttc
ttttattgcactgatagctccaaggacacagagaaggaatgcataggcaactatgtagac
cacgagaaaaacaagatggaagtgaagggccgggaatggaagcggcatgaattccactac
gacaacatcatatgggccctgctgaccctcttcaccgtctccacgggggaaggatggcct
caggttctacagcattctgtagatgtgacagaggaggaccgaggccccagccgcagcaac
cgcatggagatgtccatcttttacgtggtctactttgtcgtcttccctttcttctttgtc
aatatcttcgtggctctcatcataatcaccttccaggagcaaggagacaagatgatggag
gagtgtagcctggaaaagaatgagcgagcatgcattgacttcgctattagtgccaaacct
ctcacccgctacatgccacagaacaggcacaccttccagtatcgtgtgtggcactttgtg
gtttctccgtcctttgagtataccatcatggccatgatcgccttgaatactgtcgtgctg
atgatgaagtactactctgctccctgtacctatgaactggccctaaagtacctgaacatt
gccttcaccatggtgttttccctggaatgtgtcctaaagatcatcgcttttggtttcttg
aactatttccgagacacctggaatatctttgacttcatcactgtgattggcagtattaca
gaaattatcctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctg
aagctctttcgagcagcgcgcctcataaagcttctgcgtcaaggctacaccatacgcatt
ttactctggacctttgtacagtcctttaaggccctgccctatgtttgcctgctgattgcc
atgcttttcttcatttatgccatcattgggatgcaggtatttggaaacataaaattagat
gaggagagtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctg
ctcttcaggagtgccacaggtgaggcctggcaggagattatgctgtcctgtcttggggag
aaaggctgtgagcctgacaccactgcaccatcagggcagacggagaacgagcgctgcggc
acggatctggcctacgtttactttgtctccttcatcttcttctgttccttcctgatgctc
aacctgtttgtggctgtaatcatggacaacttcgagtacctgactcgagattcctccatc
ctgggacctcaccacttggatgagtttgtccgcgtctgggcagaatatgacagagcagca
tgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgcta
ggcctcggcaagagatgtccctccaaagtggcctataagaggttggtcctgatgaatatg
ccagtagctgaggacatgacagtccacttcacctccacacttatggctctgattcggaca
gctctggacattaaaattgccaaaggtggtgcagacagacagcagctagactcagagcta
caaaaagagaccctggccatttggcctcacctgtcccagaagatgctggatctgcttgta
cccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgataatg
gactactataaacagagtaaggtgaaaaagcagaggcagcagctggaagaacagaaaaat
gcacccatgttccagcgcatggagccctcatcactgcctcaggagatcattgctaatgcc
aaagccctgccttatctccagcaggaccctgtttcaggcctgagtggtcggagtggatac
ccttcaatgagtccgctctccccccaggaaatattccagttggcttgtatggacccagcc
gatgatggacaattccaggaacagcaatctctggagccagaggttagtgaattaaaaagc
gtgcagtcctctaaccatggcatctaccttccttcggacacccaggagcatgcgggatct
gggagggcatcctctatgccacgtctgactatggatccccaggtggtgacagaccctagc
tctatgagacgttcattttctacaattcgggataagcgttcaaattcctcatggttggag
gagttctccatggagcgaagcagtgaaaacacctacaagtcacggcgcagaagttaccac
tcctccctgcggctgtcagcacaccgcctgaattctgactctggccacaagtctgacact
caccgctctggaggtagagagcggggccgatctaaagaacgaaagcatcttctctcccct
gatgtctctcgctgcaactcagaggagcgagggacccaggctgactgggagtctccagag
cgtcgccaatcaaggtcacctagtgagagcaggtcacagacccccaacagacagggcact
ggttccctgagtgagagttccatcccctccatctctgacaccagcaccccaagacgaagt
catcgccagcttccacctgtccccccaaagcctcggcccctcctctcctacagctccctg
atgcgacatgctggcagcatctctccacctcccaatggaagtgagggtggatccccactg
gcctctcaagccctggagagcaacagcgcttgcctgaccgagtcttccaactccctgcac
ccccagcagggccagcactcttccccacagcactacatctccgagccctacctggccctc
catgaagactcccacacctcagactgtggcgaggaggagacactcaccttcgaggcagcc
gtggctactagcttgggccgatccaacaccattggctcggccccacccctgcggcacagc
tggcagatgcccaatgggcactatcggcgtcggaggcgtggggggcctgggccaggcatg
atgtgtggagctgtcagtgacctcctgagtgacacagaagaagatgacaagtgctag

DBGET integrated database retrieval system