KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731514
Entry
103731514         CDS       T03372                                 

Gene name
Sos2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04714  Thermogenesis
ngi04722  Neurotrophin signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103731514 (Sos2)
   04012 ErbB signaling pathway
    103731514 (Sos2)
   04014 Ras signaling pathway
    103731514 (Sos2)
   04630 JAK-STAT signaling pathway
    103731514 (Sos2)
   04068 FoxO signaling pathway
    103731514 (Sos2)
   04072 Phospholipase D signaling pathway
    103731514 (Sos2)
   04151 PI3K-Akt signaling pathway
    103731514 (Sos2)
   04150 mTOR signaling pathway
    103731514 (Sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103731514 (Sos2)
   04540 Gap junction
    103731514 (Sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103731514 (Sos2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103731514 (Sos2)
   04660 T cell receptor signaling pathway
    103731514 (Sos2)
   04662 B cell receptor signaling pathway
    103731514 (Sos2)
   04664 Fc epsilon RI signaling pathway
    103731514 (Sos2)
   04062 Chemokine signaling pathway
    103731514 (Sos2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103731514 (Sos2)
   04912 GnRH signaling pathway
    103731514 (Sos2)
   04915 Estrogen signaling pathway
    103731514 (Sos2)
   04917 Prolactin signaling pathway
    103731514 (Sos2)
   04926 Relaxin signaling pathway
    103731514 (Sos2)
   04935 Growth hormone synthesis, secretion and action
    103731514 (Sos2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103731514 (Sos2)
  09159 Environmental adaptation
   04714 Thermogenesis
    103731514 (Sos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731514 (Sos2)
   05206 MicroRNAs in cancer
    103731514 (Sos2)
   05205 Proteoglycans in cancer
    103731514 (Sos2)
   05231 Choline metabolism in cancer
    103731514 (Sos2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103731514 (Sos2)
   05225 Hepatocellular carcinoma
    103731514 (Sos2)
   05226 Gastric cancer
    103731514 (Sos2)
   05214 Glioma
    103731514 (Sos2)
   05221 Acute myeloid leukemia
    103731514 (Sos2)
   05220 Chronic myeloid leukemia
    103731514 (Sos2)
   05211 Renal cell carcinoma
    103731514 (Sos2)
   05215 Prostate cancer
    103731514 (Sos2)
   05213 Endometrial cancer
    103731514 (Sos2)
   05224 Breast cancer
    103731514 (Sos2)
   05223 Non-small cell lung cancer
    103731514 (Sos2)
  09165 Substance dependence
   05034 Alcoholism
    103731514 (Sos2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103731514 (Sos2)
   05160 Hepatitis C
    103731514 (Sos2)
   05163 Human cytomegalovirus infection
    103731514 (Sos2)
   05165 Human papillomavirus infection
    103731514 (Sos2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103731514 (Sos2)
   01522 Endocrine resistance
    103731514 (Sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ngi04990]
    103731514 (Sos2)
Domain-containing proteins not elsewhere classified [BR:ngi04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103731514 (Sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 103731514
NCBI-ProteinID: XP_008828076
LinkDB
Position
Un
AA seq 1273 aa
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVALYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSD
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILSPEFNEHFSKLMTRPTVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLP
SYSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSAIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLMERFEIPEPEPTEADKL
AIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDSELLERLDSFISSV
RGKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKELINFSKR
RKVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPISASSDHSVFLDVDLNSSCGSNSIFAPVLLPQSKTFFSSCGSLNKL
SEEPLIPPPLPPRKKFDHDASNSKGTLKSDDDPPAIPPRQPPPPKVKPRVPVATGAFDGP
MHSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWLRDVSTCPNSP
STPPSTPSPRVPRRCYLLSSSHNNLVHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPL
YRLSLLENAETPQ
NT seq 3822 nt   +upstreamnt  +downstreamnt
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagaaaaacgaaaacgaagg
aatcctcttttactacctgtggacaaaatccatccttccttgaaggaagtcttggggtat
aaagtggactaccatgtggctctctacattgtggctgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatctcagcaa
gacattaaagtgtccatgtgtgctgataaggttttgatggacatgtttgatcaggatgat
gatataggtttggtttctctctgtgaagatgagcctagttcttcgggtgaattaaactac
tatgatcttgtcagaaccgaaattgcagaagaaagacagtatcttcgggaactaaatatg
atcataaaagtatttcgagaagcctttctttctgacagaaagttgtttaagccttctgat
attgaaaagattttcagtaacatttcagatatacacgaactgactgtgaaacttttaggt
ttgattgaagatacagtagaaatgactgatgaaagtagtcctcatccattagctggcagc
tgttttgaagatttagcagaggagcaagcatttgatccttatgaaacattatcacaggat
attctttcaccagagtttaatgaacacttcagtaagttgatgaccagacctacagttgct
ctacactttcagtccattgctgatggttttaaggaagcagttcgttatgtccttccacgg
cttatgctggtaccagtatatcattgttggcattattttgaattattaaagcaattgaaa
gcatgtagtgaagagcaagaagacagggaatgtttgaatcaagctattactgctctcatg
aatctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggg
gatcctgtatgccctttttataatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacattgatgggtgggaaggcaaagatattggacagtgttgt
aatgaattcataatggaaggaccattgaccagaattggtgctaaacatgagcggcatatt
tttctctttgatggcttaatgatcagctgtaaacctaatcatggccagacccggcttcca
agttacagtagtgcagaatacagattaaaagaaaagtttgttatgaggaaaatacaaatc
tgtgataaagaagatacttgtgaatacaaacatgcttttgaattagtatccaaagatgaa
aatagcataatatttgctgctaagtcagctgaagagaaaaataattggatggccgccctt
atttctcttcattatcgaagtactctagatagaatgctggattctgtattactgaaagaa
gaaaatgaacagccactgagattaccaagtccagaagtgtatcgctttgtggtaaaagac
tctgaagaaaacattgtttttgaagacaacttgcaaagtagaagtgcaatccccatcatt
aaaggaggaactgtggtgaaattaattgaaaggctgacatatcatatgtatgcagatcct
aattttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgcta
agcttactgatggaacgatttgaaattccagaaccagaacctacggaagcagacaaattg
gcaatagagaaaggcgaacagccaatcagtgcagaccttaagagatttcgaaaggagtat
gtccagcctgtgcaacttaggatcttaaatgtctttcgtcactgggttgagcatcatttt
tatgactttgaaagagactcggaattgcttgaaagattagactccttcatttcaagtgta
agaggaaaagctatgaaaaaatgggtagagtcaattgctaagatcatcaagaggaagaag
caagctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaatt
gaatggcatataagtagaccaggacagtttgaaacatttgaccttatgacacttcatcca
atagaaattgcacgtcagttaacacttttggaatctgatctctacaggaaagtccagcct
tctgaacttgtaggaagtgtgtggaccaaagaagataaagaaataaattcccccaattta
ctgaaaatgattcggcatacaacaaaccttactctctggtttgaaaaatgcattgtggaa
gcagaaaattttgaagaacgggtggcaatactcagtagaattatagaaattcttcaagtt
tttcaagatttgaataatttcaatggcgtattggagatagtcagtgcagtaaattcagtg
tcagtgtacagactagaccatacctttgaggcattacaggaaagaaaacggagaattttg
gatgatgctgtggaattaagtcaggatcactttaaaaaatacctagtaaaacttaagtca
atcaatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaataatgattttctaaaaaagaaagggaaagaattaatcaatttcagtaagagg
aggaaagtggctgagattactggagaaattcagcagtatcagaatcagccatactgttta
cggatagaaccggaaatgaggagattttttgaaaaccttaatcccatgggaattttatct
gaaaaagagtttacagattatttgttcaacaaatcactggaaattgaaccccgaaactgt
aaacaaccacctcgatttcctaggaaatcaactttttccttaaaatctcctggaataagg
cctaatgcaggccgacatggctctacctcaggcactttacgaggtcatccgacacctttg
gaaagagaaccatataagataagctttagtcggattgctgaaactgaacttgaatcaaca
gtgtcagcaccaacctctccaaatacaccatcaaccccaccaatatccgcttcttcagac
cacagtgtgtttttagatgtggatctcaacagttcctgtggcagcaatagcatctttgct
ccagtcctcctgccacaatcaaaaactttcttcagttcatgtggtagtttaaataaacta
agtgaagagccattgattcctcctccacttcctcctcgaaagaagtttgatcatgatgct
tcaaattccaagggaactctgaaatctgatgatgaccctcctgctattccaccaagacag
cctcctcctccaaaggtaaaacccagagttcctgttgcaactggtgcatttgatggacct
atgcatagtccacctccaccacctccaagagatcctcttcctgatacccctcctccggtt
cctcttcggcctccggaacactttataaactgtccctttaatctgcagcctcctccactg
ggacatcttcacagagatccagactggctcagagacgttagtacatgtccaaattcacca
agcactcctcccagcacaccctctccaagagtaccacggcgatgctatttgctcagttca
agtcacaacaatcttgttcatcctccagctcctcctgttccaccaaggcagaattcaagc
cctcacctaccaaaactgccaccaaagacttacaaacgggagctttcacaccccccattg
tacagactgtctttgctagaaaacgccgaaactcctcaatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103743944
Entry
103743944         CDS       T03372                                 

Gene name
Sos1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04062  Chemokine signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04714  Thermogenesis
ngi04722  Neurotrophin signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04910  Insulin signaling pathway
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04917  Prolactin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04935  Growth hormone synthesis, secretion and action
ngi05034  Alcoholism
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05221  Acute myeloid leukemia
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103743944 (Sos1)
   04012 ErbB signaling pathway
    103743944 (Sos1)
   04014 Ras signaling pathway
    103743944 (Sos1)
   04630 JAK-STAT signaling pathway
    103743944 (Sos1)
   04068 FoxO signaling pathway
    103743944 (Sos1)
   04072 Phospholipase D signaling pathway
    103743944 (Sos1)
   04151 PI3K-Akt signaling pathway
    103743944 (Sos1)
   04150 mTOR signaling pathway
    103743944 (Sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103743944 (Sos1)
   04540 Gap junction
    103743944 (Sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103743944 (Sos1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103743944 (Sos1)
   04660 T cell receptor signaling pathway
    103743944 (Sos1)
   04662 B cell receptor signaling pathway
    103743944 (Sos1)
   04664 Fc epsilon RI signaling pathway
    103743944 (Sos1)
   04062 Chemokine signaling pathway
    103743944 (Sos1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103743944 (Sos1)
   04912 GnRH signaling pathway
    103743944 (Sos1)
   04915 Estrogen signaling pathway
    103743944 (Sos1)
   04917 Prolactin signaling pathway
    103743944 (Sos1)
   04926 Relaxin signaling pathway
    103743944 (Sos1)
   04935 Growth hormone synthesis, secretion and action
    103743944 (Sos1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103743944 (Sos1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103743944 (Sos1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103743944 (Sos1)
   05206 MicroRNAs in cancer
    103743944 (Sos1)
   05205 Proteoglycans in cancer
    103743944 (Sos1)
   05231 Choline metabolism in cancer
    103743944 (Sos1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103743944 (Sos1)
   05225 Hepatocellular carcinoma
    103743944 (Sos1)
   05226 Gastric cancer
    103743944 (Sos1)
   05214 Glioma
    103743944 (Sos1)
   05221 Acute myeloid leukemia
    103743944 (Sos1)
   05220 Chronic myeloid leukemia
    103743944 (Sos1)
   05211 Renal cell carcinoma
    103743944 (Sos1)
   05215 Prostate cancer
    103743944 (Sos1)
   05213 Endometrial cancer
    103743944 (Sos1)
   05224 Breast cancer
    103743944 (Sos1)
   05223 Non-small cell lung cancer
    103743944 (Sos1)
  09165 Substance dependence
   05034 Alcoholism
    103743944 (Sos1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103743944 (Sos1)
   05160 Hepatitis C
    103743944 (Sos1)
   05163 Human cytomegalovirus infection
    103743944 (Sos1)
   05165 Human papillomavirus infection
    103743944 (Sos1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103743944 (Sos1)
   01522 Endocrine resistance
    103743944 (Sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ngi04990]
    103743944 (Sos1)
Domain-containing proteins not elsewhere classified [BR:ngi04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103743944 (Sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 103743944
NCBI-ProteinID: XP_008843731
LinkDB
Position
Un
AA seq 1334 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSY
DVENIFSRIVDIHELSIKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQEIQFLMLEKFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSTSPFHSSSDTVFIQVTLPHGPRSASVSSIS
LTKGTDEVPVPPPVPPRRRPESAPVESSPSKIMPKHLDSPPAIPPRQPTSKAYSPRYSVS
DRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPP
PPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSM
HRDGPPLLENAHSS
NT seq 4005 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaggagaatgcacccaagtggcgg
gggctgctggtgccggcgctgaaaaaggttcaggggcaagttcatcctactcttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctctgc
caagctcagccccggagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcggctattgaaaagaggaagagaaga
aaccctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaatcgaccaccaggtttctgtttacatagtagcagtattagaatatatttctgctgat
attttaaagctggtggggaattatgtaagaaatatacggcattatgaaattacgaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagagaactaaac
ctaattataaaagtttttagagagccctttgtctctaattccaaattgttttcatcttat
gatgtagaaaacatatttagtcgtatagtggatatacatgaacttagtataaagttactg
ggccatatagaagacactgtagaaatgacagatgaaggcagtccccatccattagtagga
agctgttttgaagacttagcagaggaactggcatttgacccatatgaatcatatgctcga
gatattttacgaccaggatttcatgaccgtttccttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggggaaggtttcaaagaagctgttcagtatgttttaccc
cggctgcttcttgcccctgtgtaccactgtctgcattactttgaactcctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
ctcaatgttcaaagtggtatggaaaaaatatgttctaaaagccttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagccaacaaatgaaggggaaacaactagcgatcaag
aaaatgaacgagattcagaagaatattgatggttgggaagggaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatctgctgtaaatcaaatcatggacagccaagacta
cctggtgctagcaatgcagaatatcgtctgaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccagtgaatacaagcatgcttttgaaataattctgaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaactggatggcagca
ttgatatctttacagtaccggagtacactggaaagaatgcttgatgtaacaatgctacag
gaagagaaggaggagcagatgaggctgcctagtgctgatgtatataggtttgcagaacct
gactctgaggagaatattatatttgaagagaacatgcagcccaaggctggaattccaatc
atcaaagcaggaactgttgttaaacttatagagagacttacataccatatgtatgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaaatt
cagtttttgatgcttgaaaaatttgaaataccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccctaagtgcagaactgaaaaggtttagaaaagaa
tatatacagcctgtacaactgagagtgttaaatgtatgccggcactgggtggagcaccac
ttttatgattttgaaagagatgcagatcttttacaaagaatggaagaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaagataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcaaagttcacctcccaca
gttgagtggcacataagcagacctgggcatatagagacttttgacttgctcaccttacac
ccaatagaaattgctcgacagcttactttacttgaatctgatctataccgagctgtgcag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcccaat
cttctgaaaatgatacgacacaccaccaatcttactctgtggtttgaaaaatgtattgta
gaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagttgaacaatttcaatggtgtccttgaagttgtcagtgctatgaactca
tcacctgtttacaggctagaccacacatttgagcaaataccaagtagacaaaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccgtgtgtgcctttctttggaatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaagtcctaaaaagacatggaaaagaacttatcaactttagcaaa
agaaggaaagtggcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagacatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagactaccttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatacagctatcccctaaaatctcctggtgtt
cgtccatcgaacccaagaccaggaactatgaggcaccccacacctctgcagcaggagcca
agaaaaatcagttatagtcggatccctgaaagtgaaacagaaagtacagcatccgcacca
aattctccgagaacaccgctgacacctcctcctgcttctggtgcttccagtaccacagat
gtttgcagtgtgtttgattccgaccattcaacaagcccttttcactcaagcagcgatacc
gtctttatccaagttacactgccccatggtccaagatctgcttcagtatcatctataagt
ttgaccaaaggcactgatgaagtgcctgtcccccctcctgttcctcctcgaagacgacca
gaatctgccccagtggaatcttcgccatctaagattatgcctaagcacttggacagtccc
ccagctattcctcccaggcaacccacatcaaaagcctattcaccacgatattcagtatca
gaccggacctctatatcagaccctcctgaaagccctcccttgttgccaccacgagaacct
gtgaggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggc
aaaaagagtgaccatggcaatgccttcttcccaaacagcccttccccctttacaccacca
cctcctcaaaccccttctcctcatggcacaagaaggcacctgccatcaccaccactgaca
caagaagtggacctccattccattgctgggccacctgttcctccacgacaaagcacttct
cagcatatccctaaactccctccaaaaacttacaaaagggagcacacgcatccatccatg
cacagagatggaccaccactgttggagaatgcccactcttcctga

DBGET integrated database retrieval system