KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731594Help
Entry
103731594         CDS       T03372                                 

Gene name
Abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00250  Alanine, aspartate and glutamate metabolism
ngi00280  Valine, leucine and isoleucine degradation
ngi00410  beta-Alanine metabolism
ngi00640  Propanoate metabolism
ngi00650  Butanoate metabolism
ngi01100  Metabolic pathways
ngi04727  GABAergic synapse
Module
ngi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    103731594 (Abat)
   00650 Butanoate metabolism
    103731594 (Abat)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103731594 (Abat)
   00280 Valine, leucine and isoleucine degradation
    103731594 (Abat)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103731594 (Abat)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103731594 (Abat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ngi01007]
    103731594 (Abat)
Enzymes [BR:ngi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     103731594 (Abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     103731594 (Abat)
Amino acid related enzymes [BR:ngi01007]
 Aminotransferase (transaminase)
  Class III
   103731594 (Abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103731594
NCBI-ProteinID: XP_008828173
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MAFLLLTRRLACSSRQNLWLLTSGSRYISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQ
NASTFINRPALGILPPENFVDKLRQSLMSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQRGFSKEELETCMINQGPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKDNEQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMM
TGGFFHKEEFRPSAPYRIFNTWLGDPAKNLLLAEVINVIKREDLLNNVAHAGKTLLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDESIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttcttgttgcttacccggcggctagcctgcagctcccggcaaaacctctggctc
ctcacatctggatccagatacatcagtcaagctgccgccaaagtggatgttgaatttgat
tacgatgggccactgatgaagacggaagtcccagggcctagatctcaggagttaatgaaa
cagctgaacacaattcagaatgcagaggctgtgcattttttctgcaattatgaagagagc
cgaggcaactacctggtggatgtggatggcaaccgtatgttggacctctattcccagatc
tcatctgtccccataggttacaaccatccagctctggcgaaactcgtccaacagcctcaa
aatgcgagtactttcatcaacagacctgccctaggcatcttgcctccagagaacttcgtg
gacaagctccggcagtccttgatgtctgtggcacccaaaggcatgtcccagctcatcacc
atggcctgtggctcctgctccaatgagaatgcattcaagaccatcttcatgtggtaccgg
agcaaggaacgaggacagagaggattctcaaaagaggagctggagacctgcatgattaat
cagggccccggatgccctgactacagcatcctctccttcatgggtgctttccacgggagg
accatgggttgcttagcgaccacacactccaaagcaattcacaagattgatatcccttcc
tttgactggcccattgctccgttcccacggcttaaataccctctagaagagtttgtgaag
gacaatgagcaggaggaggcccgctgcctggaagaggtggaggatctgatcgtgaaatat
cggaaaaagaagaggacggtggcggggatcatcgtggagcccatccagtctgagggtgga
gacaaccatgcatcggatgacttctttcggaagctgagagacatcgccaggaagcatggc
tgtgccttcttggtggatgaggtccagaccggtggaggttgtactggcaagttctgggcc
catgagcactggggcttggatgacccagcagatgtaatgtcattcagcaagaagatgatg
accgggggcttcttccacaaagaggagttccggcccagtgctccttaccgaatcttcaac
acctggctaggggacccagccaagaacttgctgctagctgaggtcatcaacgtcatcaag
cgggaggacctgctcaacaatgtggctcatgctgggaagaccttgctcacagggctactg
gacctccaggcccggtatccccagttcatcagcagagtgagaggtcgaggcaccttttgc
tccttcgacactccagatgaatccatacggaataaactcatcttaattgccagaaacaaa
ggtgtggtgttggggggctgtggagacaaatccatccgtttccgtcccacactggtcttc
agggatcaccatgctcacctgttcctcaacattttcagtgacatcctagccaacttcaag
taa

DBGET integrated database retrieval system