KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731682
Entry
103731682         CDS       T03372                                 

Gene name
Mmp2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04670  Leukocyte transendothelial migration
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04926  Relaxin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05219  Bladder cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103731682 (Mmp2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103731682 (Mmp2)
   04915 Estrogen signaling pathway
    103731682 (Mmp2)
   04926 Relaxin signaling pathway
    103731682 (Mmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103731682 (Mmp2)
   05205 Proteoglycans in cancer
    103731682 (Mmp2)
  09162 Cancer: specific types
   05219 Bladder cancer
    103731682 (Mmp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103731682 (Mmp2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103731682 (Mmp2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103731682 (Mmp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103731682 (Mmp2)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     103731682 (Mmp2)
Peptidases and inhibitors [BR:ngi01002]
 Metallo peptidases
  Family M10
   103731682 (Mmp2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 CBM60 Reprolysin_4
Other DBs
NCBI-GeneID: 103731682
NCBI-ProteinID: XP_008828308
LinkDB
Position
Un
AA seq 662 aa
MEAQGAWGALASALRAFCVLSCLLGRAIAAPSPIIKFPGDVTPKTDKELAVQYLNTFYGC
PKENCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFS
GREYNSCTDTGRSDGFLWCSTTYDFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
AYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKH
ESCTSAGRSDGKMWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSHDDIKGIQELYGASPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQRIDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggaggcacaaggagcatggggagccctcgccagcgctctgcgggcgttctgcgtcctg
agctgccttctgggtcgcgccatcgccgcaccgtcgcccatcatcaagttccctggcgat
gtcacccccaaaacggacaaagagttggcagtgcaatacctgaacaccttctatggctgc
cccaaggagaactgcaacctgtttgtgcttaaggataccctcaagaagatgcagaagttc
tttgggttgcctcagacaggtgacctcgaccagaacaccatcgagaccatgaggaagcca
cgctgtggcaacccagatgtggccaactataacttctttccccgcaagcccaagtgggac
aagaaccagatcacatacagaatcattggttacactcccgacctggatcctgagacagtg
gatgatgccttcgctcgggccttacaagtgtggagcgatgtgactccactacgcttttct
cgcatccatgatggggaagctgacatcatgatcaactttggccgctgggaacacggagac
ggatacccctttgatggcaaagacgggctcctggcgcatgcctttgccccaggcactggt
gttggaggagactctcactttgatgatgatgagctgtggaccctgggggaagggcaagtg
gtccgggtgaagtacgggaatgccgatggggagtactgcaagttccccttcctgttcagt
ggccgagaatacaacagctgcactgacactggccgcagtgacggcttcctctggtgctcc
accacctatgacttcgagaaggatggcaagtacggcttctgcccccatgaagccctgttc
accatgggtggcaatgctgatggacagccctgcaagttcccgttccgcttccagggcacc
gcctacaacagctgcaccacagagggccgcacggacgggtatcgctggtgtggcaccact
gaggactatgaccgagacaagaagtatgggttctgcccggagaccgccatgtccactgtg
ggtgggaattcggaaggcgccccatgtgtcttccccttcaccttcctgggcaacaagcat
gagagctgcaccagtgctggccggagcgatgggaagatgtggtgcgcaaccaccactaac
tatgatgatgaccggaagtggggtttctgccctgaccaaggatacagcctgttcctcgtg
gcagcccatgagtttggccatgccatggggctggaacactcacaggaccctggggccttg
atggcacccatctatacctacaccaagaacttccgcttgtcccatgatgatatcaaggga
attcaggagctctatggggcctcccctgatgcagacactgacactggcactggccccacc
cctacactgggacctgtcactcctgagatttgcaaacaggacattgtctttgatggcatt
gcccagattcgtggtgagatcttcttcttcaaggaccggtttatttggcggacagtgaca
ccacgtgacaagcccatgggccccttgttggtggcgacattctggcctgagctcccagaa
aagatagatgctgtgtacgaggccccacaggaggagaaggctgtgttctttgcagggaat
gagtactgggtctattctgccagcaccctggagcgagggtaccccaagcccctgaccagc
ctggggttgccccctgatgtccagcgcatagatgcggcctttaactggagcaagaacaag
aagacatacatcttcgctggagacaaattttggagatacaatgaggttaagaagaaaatg
gatcctggcttccccaagctcattgcagatgcctggaatgccatccctgataacctggat
gctgtcgtggacctgcagggcggtggtcacagctacttcttcaaaggtgcttattacctg
aagttggagaaccaaagtctgaagagtgtgaagtttggaagcatcaaatcggactggttg
ggctgttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103751232
Entry
103751232         CDS       T03372                                 

Gene name
Mmp9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04657  IL-17 signaling pathway
ngi04668  TNF signaling pathway
ngi04670  Leukocyte transendothelial migration
ngi04915  Estrogen signaling pathway
ngi04926  Relaxin signaling pathway
ngi05161  Hepatitis B
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05215  Prostate cancer
ngi05219  Bladder cancer
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103751232 (Mmp9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103751232 (Mmp9)
   04670 Leukocyte transendothelial migration
    103751232 (Mmp9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103751232 (Mmp9)
   04926 Relaxin signaling pathway
    103751232 (Mmp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103751232 (Mmp9)
   05202 Transcriptional misregulation in cancer
    103751232 (Mmp9)
   05206 MicroRNAs in cancer
    103751232 (Mmp9)
   05205 Proteoglycans in cancer
    103751232 (Mmp9)
  09162 Cancer: specific types
   05219 Bladder cancer
    103751232 (Mmp9)
   05215 Prostate cancer
    103751232 (Mmp9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103751232 (Mmp9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103751232 (Mmp9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103751232 (Mmp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ngi01002]
    103751232 (Mmp9)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     103751232 (Mmp9)
Peptidases and inhibitors [BR:ngi01002]
 Metallo peptidases
  Family M10
   103751232 (Mmp9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Reprolysin_4 DUF4953 Peptidase_M66 Reprolysin_3 Reprolysin_5
Other DBs
NCBI-GeneID: 103751232
NCBI-ProteinID: XP_008852829
LinkDB
Position
Un
AA seq 710 aa
MNPWQPLTSVFLVLGCCSAAPHGHQSTFVVFPRDLRTTNLTDSQLAQEYLFRYGYTRVAE
MQGEKLSLRPALLLLQKQLSLPQTGELDSKTLEAIRTPRCGVPDLGKFQTFEGDLKWHHT
NITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTHFGNANGAPCHFPFTFEGR
SYLACTTDGRTDGTPWCSTTADYDTDRQFGFCPSERLYTEHGNGDGKPCVFPFTFDGRSY
SACTTEGRSDGYRWCATTPNYDQDKLYGFCPTRADATVIGGNSAGKLCKFPFIFLGKEYS
TCTSEGRTDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSTVPEALM
YPMYRFLEGSPLHEDDVRGIQHLYGPGPKPDPRPPATTTAQPQPTVPPTVCPTAPPTAYP
SEQPTVGPTGAPSAGPTGPPTAGPSEAPTVSLGPADNPCNVNIFDAITEIQGSLHFFKNG
RYWKFSELRGRQLQGPFLIARSWPALPAKLDSAFEDPQSKKIFFFSGRQVWVYTGQSVLG
PRRLDKLGLGSGVTQVTGVVRHRGGKALLFSGERVWRFNLKTQTVDPQSVTSLDRVFSGV
PRNAHDVFQYREKVYFCQDRFFWRVTSWNEVNQVDQVGYVTYDILQCRED
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgaacccctggcagcccctgacctcagtgttcctggttctaggctgctgctctgccgcc
cctcacgggcaccagtctacttttgtggtcttcccccgggatctgagaaccaccaatctc
accgactcgcagctggcacaggaatacctgttccgatatggttacacccgggttgctgag
atgcaaggagagaagctatccctgcggccagcactactgctccttcagaagcagctgtcc
ctgccccagactggagagctagacagcaaaaccctagaggctattcgtaccccacgctgt
ggtgtcccagacctgggcaaattccaaaccttcgagggtgacctcaagtggcaccacacc
aacatcacttactggatccaaaactactcggaagacttgccgcgagacgtgatcgatgac
gccttcgctcgcgccttcgcggtgtggagcgcagtgacaccgctcaccttcacccgcgtg
tacagtcgtgacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtat
cccttcgacgggaaggatgggctcctggcacacgcgtttcctcctggccccgggattcag
ggtgatgcccacttcgacgatgaagaactgtggtcgctgggcaaaggcgttgtggttccc
acacactttggaaacgctaatggtgccccgtgtcacttccccttcaccttcgagggccgc
tcctacttggcctgcaccacagatggccgcacggatgggacaccttggtgcagcaccacc
gcggactatgacacagaccgccagtttggcttctgccccagcgagagactctacactgaa
catggcaatggggacgggaaaccctgtgtgtttccattcaccttcgacggccgttcctac
tctgcctgcaccactgaaggtcgttcggatggctaccgctggtgtgctaccacccccaac
tacgaccaggataaactctatggcttctgccctacccgagctgacgccactgtgattggt
ggcaactccgcaggcaagctgtgcaaattccccttcatcttcctgggcaaggagtactcc
acctgtaccagcgagggccgaactgatgggcgcctttggtgcgccaccacctccaacttc
gacagcgacaagaagtggggtttctgccctgatcaaggatacagccttttcctggtggca
gcacatgagtttggccacgcactgggcttggatcattcgacagtgccagaggcgctcatg
tatcccatgtaccgcttccttgagggctcccctctgcatgaggatgatgtgagaggcatc
cagcatctctatggtcctggccctaagcctgacccaaggcctccagccacaaccacagct
caaccacagcccacagttcctcctactgtctgccccactgcacctccgactgcctacccc
tctgagcagcccacggttggccctacaggtgccccctcagctggccctacaggtcccccc
actgctggcccttctgaggctcctacagtgtctttgggtccagcagacaatccctgcaac
gtgaatattttcgacgccatcacggaaattcagggttctttgcatttcttcaagaatggc
cggtactggaagttctcagagctcagaggacgccagctgcagggcccgtttctcattgcc
cgctcgtggccggctttgccagctaagctggactccgcgtttgaggacccacagtccaag
aagattttcttcttctctgggcgccaagtgtgggtgtacacaggccagtcggttctgggc
ccgaggcgcctggacaagctgggtctcggctcgggggtgacccaagtcaccggggtcgtc
cggcatcgcgggggaaaggcgctgctgttcagcggggagcgtgtctggaggttcaacttg
aagacgcagaccgtggatccccagagcgtcactagcctggacagggtgttctccggggtg
ccccggaacgcgcacgacgtctttcagtaccgagagaaagtctacttctgccaggaccgc
tttttctggcgcgtgacttcctggaacgaggtgaaccaggtggaccaagtgggctatgtg
acctatgacatcctgcagtgccgtgaggactag

DBGET integrated database retrieval system