KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103731814
Entry
103731814         CDS       T03372                                 

Gene name
Cacna1s
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04723  Retrograde endocannabinoid signaling
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05410  Hypertrophic cardiomyopathy
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103731814 (Cacna1s)
   04020 Calcium signaling pathway
    103731814 (Cacna1s)
   04024 cAMP signaling pathway
    103731814 (Cacna1s)
   04022 cGMP-PKG signaling pathway
    103731814 (Cacna1s)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103731814 (Cacna1s)
   04929 GnRH secretion
    103731814 (Cacna1s)
   04912 GnRH signaling pathway
    103731814 (Cacna1s)
   04921 Oxytocin signaling pathway
    103731814 (Cacna1s)
   04935 Growth hormone synthesis, secretion and action
    103731814 (Cacna1s)
   04924 Renin secretion
    103731814 (Cacna1s)
   04925 Aldosterone synthesis and secretion
    103731814 (Cacna1s)
   04927 Cortisol synthesis and secretion
    103731814 (Cacna1s)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103731814 (Cacna1s)
   04261 Adrenergic signaling in cardiomyocytes
    103731814 (Cacna1s)
   04270 Vascular smooth muscle contraction
    103731814 (Cacna1s)
  09156 Nervous system
   04727 GABAergic synapse
    103731814 (Cacna1s)
   04725 Cholinergic synapse
    103731814 (Cacna1s)
   04726 Serotonergic synapse
    103731814 (Cacna1s)
   04723 Retrograde endocannabinoid signaling
    103731814 (Cacna1s)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103731814 (Cacna1s)
   05020 Prion disease
    103731814 (Cacna1s)
   05022 Pathways of neurodegeneration - multiple diseases
    103731814 (Cacna1s)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103731814 (Cacna1s)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103731814 (Cacna1s)
   05414 Dilated cardiomyopathy
    103731814 (Cacna1s)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103731814 (Cacna1s)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103731814 (Cacna1s)
Ion channels [BR:ngi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103731814 (Cacna1s)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 103731814
NCBI-ProteinID: XP_008828504
LinkDB
Position
Un
AA seq 1853 aa
MELSSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNALNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNIIQSNTAPLSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDMEDLREGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRV
FRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQILTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEEKSTIAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRAESMRNQILGYFDIAFT
SVFTVEIVLKMTTYGAILHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTVLQFMFACIGVQLFKGKFFSCNDL
SKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDANEEDTGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEEMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGLR
TIEEEAAPEIHRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFAEIEMEELESPVFLEDFPHDPRTHPLARANTNNANANVAYDNSSHSNSQV
FSSICYEREFPEETETPAARGGAFSQPCRVSGSHSKPHMDKLKGQLTQRGMHGGQVPPSP
HQVTRAEVEPAVQEERKSATPRSLEIPHSRNSDENATRGSAPQYTAPATALLVQEALVRG
GLDSLAVDANFIIATGQALADACQMEPEEVEVAATELLKQRESSEGRVMPWEA
NT seq 5562 nt   +upstreamnt  +downstreamnt
atggagctgtcctcgcctcaggatgagggcctgaggaagaagcagcccaagaaacctgtt
cctgagattctgcctaggccaccccgggccttgttctgcctgaccctccagaaccccctg
aggaaggcctgcatcagcattgtggaatggaaaccttttgagaccatcatcttgctcacc
atctttgccaactgtgtggccctggcagtgtacctgcccatgcccgaagatgataacaac
gctctgaaccttggcctggagaaactggagtacttcttcctcattgtcttctccatcgag
gctgccatgaagatcattgcctatggcttcctattccaccaggatgcctacctgcgcagt
ggctggaacgtgctggacttcatcattgtcttcctgggcgtcttcactgtgattctggaa
caagttaacatcatccaaagcaacacagcccccttgagcagcaaaggagctggcttggat
gtcaaggccctgcgagctttccgcgtactcagacccctacggctggtgtcaggggtgccc
agcctgcaggtggtcctcaactccatcttcaaggccatgctccccctattccacattgcc
ctgctcgtcctcttcatggttatcatctatgccatcattggcctggagcttttcaagggc
aaaatgcataagacctgctacttcattggaacagacattgtggccacggtggagaatgag
aaaccatcaccctgcgccaggacgggctctggacgcccatgcaccatcaatggcagtgag
tgccggggcggctggccagggcccaaccatggcatcacccacttcgacaacttcggcttc
tccatgctcaccgtgtaccagtgcatctccatggaaggatggactgacgtcctgtactgg
gtcaacgatgccatcgggaacgagtggccctggatctattttgtcaccctcattctgctg
ggctctttcttcatcctcaacctggtactgggtgtcttgagcggggagttcaccaaggag
cgggagaaggccaagtccaggggaaccttccagaagctccgggagaagcagcagctggag
gaggaccttcgaggctacatgagctggatcacacagggcgaggtcatggacatggaggac
ttgagagaaggcaagctatctttggatgaagggggctctgacacagagagcttgtatgaa
atcgaaggcttgaacaaaatcatacagttcattcggcactggcggcagtggaatcgtgtc
ttccgctggaagtgtcatgacctagtgaaatccaaggtcttctattggctggtgatcctg
attgttgccctcaacaccttatctattgcctcagaacaccacaaccagccgctctggctg
acccatttgcaagatgttgccaaccgtgtgctgctggccctcttcaccatcgagatgctg
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggaaattctgttggtggaatcaggagccatgaca
cccttgggcatctccgtgctccgctgcattcgtcttctgagactcttcaagatcaccaaa
tactggacatccctgagcaacctcgtagcatcgctgctcaactctattcgctccatcgcc
tccctgttgctgctgctcttcctctttatcatcatctttgccctgctgggcatgcagctc
tttggaggcagatatgacttcgaggacacagaagtgaggcgcagcaactttgacaacttc
ccccaggccctcatcagcgtcttccagatcctgacaggtgaagactggaactctgtgatg
tacaatgggatcatggcctacggagggccgtcctaccctggtgtgcttgtgtgcatttat
ttcatcatcctttttgtctgtggcaactatatcctgctgaacgtcttcctggctattgct
gtggacaatctggcagaggcagagagcctgacttctgcccagaaggccaaggccgaagag
agaaagcgcaggaagatgtctaaggggctcccagacaagtcagaggaagagaagtccaca
atagctaagaaactggagcagaaacccaaaggtgaaggcattcctaccactgccaagctg
aaaattgatgagtttgaatctaatgtcaatgaggtgaaagacccgtacccctcagctgac
ttcccaggggacgatgaggaagatgaacccgagatcccagtgagcccccggccacgcccc
ctggccgagctgcagttgaaagagaaggcagtacccattccagaggccagctccttcttc
atcttcagtcccaccaataagatccgtgtcctgtgccaccgcatcgtcaacgccacttgg
tttaccaatttcatcctgctctttatcctgctcagcagtgctgcactggctgctgaggac
cccatccgggccgagtccatgaggaatcagatccttggatattttgacatcgcattcacc
tctgtcttcactgtggagattgtcctcaagatgaccacctacggtgccatcctgcacaag
ggctccttctgccgtaactacttcaacatcctggatctgttggtggtggctgtgtccctc
atctctatgggactcgagtccagcgccatctctgtggtaaagatcttgagggtgctgagg
gtgctgaggccacttcgagctatcaacagagccaaagggttgaagcacgtggtgcaatgt
gtgttcgttgccatccgcaccatcgggaacattgtactggtcaccaccgtcctgcaattt
atgtttgcctgcatcggagtccaactcttcaagggaaagttctttagctgcaatgactta
tccaagatgactgaagaggagtgcaggggctactattacatatacaaggatggggacccc
acgcaaatagagctgcgtccccgccagtggatacacaatgacttccacttcgacaatgtg
ctgtcagccatgatgtcgctcttcacagtctccacctttgagggatggcctcaactactg
tacaaggccatagatgcaaatgaggaggacacaggccccatctacaataaccgggtggag
atggccatcttcttcatcatctacatcatcctcattgccttcttcatgatgaacatcttt
gtgggctttgtcatcgttaccttccaggagcagggggagactgagtacaagaactgtgaa
ctggataagaaccagcgccaatgtgtacagtatgccctgaaggcccgcccattgaggtgc
tacattcccaaaaacccctaccagtaccaggtgtggtatgttgtcacctcctcctacttt
gaatacctgatgtttgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aatcagtcagaagagatgaaccacatatcagacatcctcaacgtggccttcaccatcatc
tttaccctggagatggtcctcaagctcatagcattcaagcccaggggatattttggagac
ccctggaatgtgtttgacttcctgatcgtcattggcagcatcatcgatgtaatcctgagt
gagattgatactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
aacgttgacccagatgagagtgcccgcatctccagtgccttcttccgcctgtttcgagtc
atgaggctgatcaagctgctgagcagggcagagggagtgcgcaccctgctgtggacattc
atcaagtccttccaggccctgccttacgtggctttgctcattgtcatgctcttcttcatc
tatgctgtcatcggcatgcagatgtttgggaagattgccatggtggacggtactcagata
aaccggaacaacaatttccagactttccctcaagctgtgctgcttctcttcaggtgtgcc
acaggggaagcctggcaagagatcctgctagcctgcagctacgggaagctgtgtgatcca
gagtctgactatgccccgggtgaggagtatacatgtggcaccaactttgcctactactac
ttcatcagcttctacatgctctgtgccttcctgatcatcaatctctttgtggctgtcatc
atggacaactttgactacctcacaagggactggtccatcctgggtcctcaccacctggat
gagttcaaggctatctgggccgagtatgacccagaagccaagggcagaatcaagcacctg
gatgtggtgactctgctgagaaggatccagccccctctaggctttgggaagttctgccct
cacagggtagcatgcaagaggctggtgggcatgaacatgcccctgaacagcgatggcacg
gtcaccttcaacgccacactcttcgctcttgtgcgcacagcactcaagatcaaaacagaa
ggtaactttgagcaggccaatgaggagctgagagccatcatcaagaagatctggaagaga
accagcatgaagctcctggaccaagtcatccctccaataggagatgatgaggtgacagtg
gggaagttctatgctacgttcctcatccaggaacacttccgaaagttcatgaagcgccaa
gaggaatattatgggtatcggcctaaaaaggacacggtgcagatacaggccggactacga
accatagaagaagaagcagctcctgagatccaccgtaccatctcaggagacctgacagca
gaggaggaactggagagagccatggtggaggctgccatggaggagggaatattccggaga
accggaggcctgtttggccaagtggacaacttcctggaaaggactaattccctgcccccc
gttatggccaaccaaagacccctccaatttgctgagatagagatggaggaactggagtca
cctgtcttcctggaggacttccctcatgatccacgcacccaccctcttgctcgtgccaac
accaacaatgccaatgccaatgttgcctatgacaatagcagccatagcaacagccaggtg
ttttccagcatctgctatgaaagggagttcccagaagagacagagacacctgctgccaga
ggaggagccttcagccaaccctgcagggtctccggatcccacagcaaaccccatatggac
aagctgaaaggacagctgacccagagaggaatgcatggaggccaggtgcctccttccccc
caccaggtaacaagggcagaggtagagcctgctgtgcaagaggagaggaagagtgccaca
ccaaggtctctggaaataccccacagcaggaactctgatgagaatgctaccaggggctca
gctccacagtatacagctccagctactgccctactggttcaggaggctctggttcgaggg
ggtttagactccttagcagtggatgctaacttcatcatagcaacaggccaggccctagca
gatgcctgccagatggaaccagaggaagtggaagtggcggcaacagagctactaaagcaa
cgagagtcctcagagggcagagtcatgccctgggaggcttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739378
Entry
103739378         CDS       T03372                                 

Gene name
Cacna1c
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04742  Taste transduction
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05410  Hypertrophic cardiomyopathy
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103739378 (Cacna1c)
   04020 Calcium signaling pathway
    103739378 (Cacna1c)
   04024 cAMP signaling pathway
    103739378 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    103739378 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103739378 (Cacna1c)
   04929 GnRH secretion
    103739378 (Cacna1c)
   04912 GnRH signaling pathway
    103739378 (Cacna1c)
   04921 Oxytocin signaling pathway
    103739378 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    103739378 (Cacna1c)
   04924 Renin secretion
    103739378 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    103739378 (Cacna1c)
   04927 Cortisol synthesis and secretion
    103739378 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103739378 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    103739378 (Cacna1c)
   04270 Vascular smooth muscle contraction
    103739378 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    103739378 (Cacna1c)
   04727 GABAergic synapse
    103739378 (Cacna1c)
   04725 Cholinergic synapse
    103739378 (Cacna1c)
   04728 Dopaminergic synapse
    103739378 (Cacna1c)
   04726 Serotonergic synapse
    103739378 (Cacna1c)
   04720 Long-term potentiation
    103739378 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    103739378 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    103739378 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103739378 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103739378 (Cacna1c)
   05020 Prion disease
    103739378 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    103739378 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    103739378 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103739378 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103739378 (Cacna1c)
   05414 Dilated cardiomyopathy
    103739378 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103739378 (Cacna1c)
   04934 Cushing syndrome
    103739378 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103739378 (Cacna1c)
Ion channels [BR:ngi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103739378 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2
Other DBs
NCBI-GeneID: 103739378
NCBI-ProteinID: XP_017655291
LinkDB
Position
Un
AA seq 2189 aa
MVNENTRMYVPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGGTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIVDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNIFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKPEVVEKKPAVEETKEEKIELKSITADGESPPTTKINMDDLQPSENEDKGPYSN
PDATGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVND
TIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYV
FTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSVINVVKILXV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCS
DSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPE
LLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQ
HYGQSCLFKIAMNILNMLFTGLFTVEMILKFIAFKPKGYFSDPWNVFDFLIVIGSIIDVI
LSETNHYFCDAWNTFDALIVVGSIVDKAITKVHPAEHTQCSPSMSAEENSRISITFFRLF
RVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKISLNDTT
EINQNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGEMPCGSSF
AVFYFISFYMLCAFLIISLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGR
IKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRIALR
IKSEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFWKF
KKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAAS
EDDIFRRAGGLFGNHVTYYPSDSRNTFPQTFTTQRPLHINKTGNNQGDTESPSHEKLVDS
TFTPSSYSSTGSNANINNANNTALGHFPHPTSYSSTVSTMEGHGPPLSPAIRVQEAAWKL
SSKRCHSRESQGAMVSREEVLPDETCTVRIGEDTEYCSEPSLLSTEMLSYQDDEHRQLAS
LEEDKREIRQSPKRSFLRSASLGRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALA
VAGLSPLLQRSHSPTTFPRPCPTPPVTPGNLGRPLQPIPTLRLEGAESSEKLNSSFPSIH
CSSWSEETTACSGGSSMARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFA
QDPKFIEVTTQELADACDMTIEEMENAADNILSGGTQQNPNGTLLPFVNCRDPGEDRAGV
PEDESCAFALGRGRSEEALADSRAFVSNL
NT seq 6570 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaccaggatgtacgttccggaggaaaaccaccaaggttccaactat
gggagcccacgcccagcccatgccaacatgaatgccaatgcagcagcggggctcgcccct
gagcacatccctactccaggggcagccctgtcctggcaggcagccatcgatgccgcccgg
caggccaagctgatgggcagtgctggcaatgcgaccatctctacggtcagctccacacag
cggaagcggcagcagtatgggaaacccaagaagcagggtggtacgaccgccacacggccg
ccccgtgccctgctctgcctgactctgaagaaccctatcaggagggcatgcatcagcatc
gttgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcaatctatattcccttcccagaagatgactccaacgccaccaactccaacctggaa
cgagtggaatatctctttctcataatttttaccgtggaagcatttttaaaagtaattgcc
tatggacttctctttcaccccaacgcttacctccgcaatggttggaatttactagatttt
ataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagctgatggg
gccaatgctctaggagggaaaggagctggattcgatgtgaaggcactgagggctttccga
gttctgcgtcccctgcggctggtgtctggagtcccaagtctccaggtggtcctgaactcc
atcatcaaggccatggtgcctctgctgcacattgccttgcttgtgctgttcgtcatcatc
atctacgccatcatcggcctggagctcttcatgggaaagatgcataagacctgctacaac
caggagggcatagtagatgttccagcagaagaggacccttctccttgtgctttggagaca
ggccatgggcggcagtgtcagaatgggaccgtgtgcaagcccgggtgggatgggcccaag
cacggcatcaccaacttcgacaacttcgcctttgccatgctgacagtgttccagtgcatc
accatggagggctggacagatgtgctatactgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttttccaaagagagggagaaggccaaggctcggggagat
ttccagaagcttcgagagaagcagcagctagaagaagatctcaaaggctacctggactgg
atcacccaggcagaagacattgaccctgagaacgaggatgagggcatggatgaagaaaag
ccccgcaacatgagcatgcccacaagtgagactgaatctgtcaacactgaaaatgtggct
ggaggtgacatcgagggcgaaaactgtggagccagactggcccaccggatctccaaatcc
aagttcagccgctactggcgcaggtggaaccgattctgcagaagaaagtgtcgtgcagcc
gtcaagtccaacatcttctactggcttgtgatcttccttgtgttcctcaatacactcacc
attgcctctgaacattacaaccagccccactggctcacagaagtgcaagacacagccaat
aaggccctcctggccctttttactgcagaaatgctcctgaagatgtatagcctaggcctg
caggcctatttcgtatccctcttcaaccgctttgactgcttcatcgtgtgtgggggcatc
ctggagaccatcctggtggagaccaaaatcatgtctcccttgggcatctctgtgctgaga
tgtgtacggctgctcaggatctttaagatcaccaggtactggaactccttgagcaacctc
gtggcatccttgctgaactctgtccgctccattgcctccctgttgcttctccttttcctc
ttcatcatcatcttctcccttctggggatgcagctgtttggaggaaagttcaactttgat
gagatgcagacacgcaggagcacctttgataacttcccgcagtccctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgcggtggacaatctggctgatgcggag
agcctcacctctgcacaaaaggaggaagaagaagagaaagagagaaagaagctggccagg
actgccagcccagagaagaagccggaggtggtagagaagaagccagcggtggaggagacc
aaggaggagaaaattgaactgaagtccattactgcagatggagagtccccacccaccacc
aagatcaacatggatgacctccaacccagtgaaaatgaggataagggtccctactccaac
ccagatgccacaggagaagaggatgaggaggagcctgagatgcctgtggggccacgccct
cggcccctgtctgagctgcaccttaaggaaaaggcagtgcccatgcctgaagccagtgca
tttttcatctttagccccaacaacaggtttcgcctccagtgccaccgcattgtcaatgac
acgatcttcaccaacctgatcctcttcttcattttgctcagcagcatctctctggctgct
gaggaccccgtccagcacacctccttcaggaaccatattctgttttattttgacattgtt
ttcactaccattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattatccttaagatgactgcttatggggctttcctg
cacaagggctctttctgccgaaattacttcaacatcctggacctgctggtggtcagcgtg
tccctcatctcttttggcatccagtccagtgtgatcaacgttgtgaagatcttataagtg
cttcgagtcctcaggcccctcagggccatcaacagagccaaggggctaaagcatgtagta
cagtgtgtgtttgtggccatccggaccatcgggaacattgtaattgtcaccacgctgctg
cagttcatgttcgcctgcattggagtccagctcttcaagggaaaactctacacctgttca
gatagttccaaacagacagaggcagaatgcaagggtaactatatcacatataaagatgga
gaggttgaccatcccattatccagccccgcagctgggagaacagcaagtttgactttgac
aatgttctggcagccatgatggccctcttcactgtctccacctttgaggggtggccagag
ctgctgtatcgctccatcgactcccacacagaagacaagggccccatctacaactaccgt
gtggagatctccatcttcttcatcatttacatcatcatcatcgcctttttcatgatgaac
atctttgtgggtttcgtcatcgtcaccttccaagagcaaggggaacaagagtacaagaac
tgtgagctggacaagaaccagcgacagtgtgtagaatacgccctcaaggcccgacccctg
cggaggtacatccccaagaaccagcaccagtacaaagtgtggtatgtggtcaactctacc
tacttcgagtatctgatgttcgttctcatcctgctcaacaccatctgcctggccatgcag
cactatggccagagctgcctgttcaaaattgccatgaacatactcaacatgctcttcact
ggcctcttcactgtggagatgatcctgaagttcattgccttcaaacccaagggttacttt
agtgatccctggaatgtttttgacttcctcatcgtgattgggagcataattgatgtcatt
ctcagtgagactaatcactatttctgtgatgcatggaatacatttgacgccttgattgtt
gtgggtagcattgttgataaagcaatcaccaaggtacacccagctgaacatacccaatgc
tctccctctatgagtgcagaggagaactcccgcatctccatcaccttcttccgcctcttc
cgggtcatgcgcctggtgaaactgctgagccgcggagaaggcatccggaccctgctgtgg
accttcatcaagtccttccaggccctgccctatgtggcccttctgattgtgatgctgttc
tttatctatgcagtgattgggatgcaggtgtttgggaagatttccctgaatgacaccaca
gagatcaatcagaacaacaacttccagaccttccctcaagctgtgctactgctcttcagg
tgtgccactggggaggcctggcaggacatcatgctggcctgcatgccaggcaagaagtgt
gccccagagtcagagcccggcaacagcacagaaggagagatgccctgtggcagcagtttt
gctgtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcagcctcttt
gtagctgttatcatggacaactttgactacctgacaagggattggtctatccttggtccc
catcatctggatgaatttaaaagaatctgggcagagtatgaccctgaagccaagggtcgg
atcaaacacttggatgtggtgaccctcctccgaaggattcagccgcccctgggctttggg
aagctgtgtcctcaccgtgtggcctgcaaacgcctggtctccatgaatatgcctctgaac
agcgatgggacagtcatgttcaatgccaccctgtttgccctggtcaggatagccctgagg
attaaatcagaagggaacctagaacaagccaatgaggagctgcgagccatcataaagaag
atctggaagaggaccagcatgaagctgctggaccaggtggtgccccctgcaggcgatgat
gaggtcacagtaggcaagttttatgctactttcctgatccaagagtacttctggaaattc
aagaagcgcaaagagcagggactggtgggcaagccctcgcagaggaacgcactatccctg
caggctggcttgcgcacgctgcatgacattggtcctgagatccgccgggccatctctgga
gatctgactgctgaggaggagctggacaaagccatgaaggaggctgtgtctgctgcctcc
gaagatgacatcttcaggagggccggaggcctgtttggcaaccacgtcacctactatcca
agtgacagcaggaatacctttccccagaccttcaccacccagcgcccactgcatatcaac
aagaccggaaacaaccaaggtgacaccgagtcgccatcccatgagaaacttgtggactcc
acgttcacccccagtagctactcatccactggctccaatgccaacatcaacaacgccaac
aacactgccttgggccactttccccaccccaccagctactccagcacagtcagcactatg
gagggccatgggcctcccttgtctcctgctatccgagtacaggaggcagcatggaagctc
agttccaagaggtgccactcacgagagagccagggagccatggtgagtagggaggaggta
ttaccagatgagacgtgcacggtgcggatcggtgaagatactgagtactgcagcgagccc
agcctgctctccacagagatgctctcctaccaggatgatgaacatcgacaactagcatct
ctagaggaggacaagagggagatccggcagtctccaaagaggagtttccttcgctctgcc
tctcttggtcgaagggcttccttccacctggaatgtctgaagcgacaaaagaatcaaggg
ggagatatctctcagaagacagtcctgcccttgcatctggttcatcatcaggcgttggca
gtggcaggcttgagccccctcctacagagaagccattcccctaccacattccccaggcca
tgccccacgccccctgtcactccaggcaacctgggcaggcccctgcagcccatccccacc
ctacggctggagggggctgagtccagcgagaaactcaatagcagcttcccatccatccac
tgcagctcctggtctgaggagaccactgcctgtagtgggggcagcagcatggcccggaga
gcccggcctgtctccctcactgtgcccagccaggctggagctcctggaagacagttccac
ggcagtgccagcagcctggtggaagcggtcttgatttctgaaggactggggcagttcgct
caagatcccaagttcatcgaggtcactacccaggagctggctgatgcctgcgacatgacg
atagaggagatggagaatgccgcagacaacatcctcagtgggggcacccagcagaacccc
aatggcaccctcttaccttttgtgaactgcagggaccccggggaggacagggctggggtc
ccggaggacgagagctgtgcatttgccctgggccggggccgcagcgaggaggcgctcgcg
gacagtagggccttcgtcagcaacctgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103741673
Entry
103741673         CDS       T03372                                 

Gene name
Cacna1f
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04723  Retrograde endocannabinoid signaling
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05410  Hypertrophic cardiomyopathy
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103741673 (Cacna1f)
   04020 Calcium signaling pathway
    103741673 (Cacna1f)
   04024 cAMP signaling pathway
    103741673 (Cacna1f)
   04022 cGMP-PKG signaling pathway
    103741673 (Cacna1f)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103741673 (Cacna1f)
   04929 GnRH secretion
    103741673 (Cacna1f)
   04912 GnRH signaling pathway
    103741673 (Cacna1f)
   04921 Oxytocin signaling pathway
    103741673 (Cacna1f)
   04935 Growth hormone synthesis, secretion and action
    103741673 (Cacna1f)
   04924 Renin secretion
    103741673 (Cacna1f)
   04925 Aldosterone synthesis and secretion
    103741673 (Cacna1f)
   04927 Cortisol synthesis and secretion
    103741673 (Cacna1f)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103741673 (Cacna1f)
   04261 Adrenergic signaling in cardiomyocytes
    103741673 (Cacna1f)
   04270 Vascular smooth muscle contraction
    103741673 (Cacna1f)
  09156 Nervous system
   04727 GABAergic synapse
    103741673 (Cacna1f)
   04725 Cholinergic synapse
    103741673 (Cacna1f)
   04726 Serotonergic synapse
    103741673 (Cacna1f)
   04723 Retrograde endocannabinoid signaling
    103741673 (Cacna1f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103741673 (Cacna1f)
   05020 Prion disease
    103741673 (Cacna1f)
   05022 Pathways of neurodegeneration - multiple diseases
    103741673 (Cacna1f)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103741673 (Cacna1f)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103741673 (Cacna1f)
   05414 Dilated cardiomyopathy
    103741673 (Cacna1f)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103741673 (Cacna1f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103741673 (Cacna1f)
Ion channels [BR:ngi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103741673 (Cacna1f)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 103741673
NCBI-ProteinID: XP_008840819
LinkDB
Position
Un
AA seq 1912 aa
MSESEDGKGESRHLPLLXTLGASIVEWKPFDILILLTIFANWVALRVYIPFPEDDSNTAN
HNLEQMEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVWLFSVLLEQGP
GQPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIVPLV
LFVIIIYAIIGLELFLGRMHKTCYFLGSGMEAEEDPSPCASSGSGRSCTLNQTECXGHWP
GPNSGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLIIFGSFFVL
NLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEELHGYLDWITQAEELDFDDPTADGN
LGSLAEEDRAGHRPQLAELTNRRCGRLHWFSHSTCSTHSTSSHASLPASDTGSMVDTPGN
EDEEEGALAGCTHCLNKIMKTKICHHLHQANQCLQAGCRRAVKSNACYWAVLLLVFLNTL
TIASEHHGQPVWLTQTQEYANKVLLCLFKVEMLLKLYGLGPSAYVASFFNCFDCFVVCGG
ILETTLVEVGVMQPLGISVLRCVRLLRIFKITRHWASLSNLVESLLNSMKSITSLLLLLF
LFIIIFSLLSMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQTLTGEDWNVVMYDGIMAY
GGPFFPGMLVCVYFIILFICCNYILLNVFLAIAVDNLASRDAGTAKNKGREKSREGNPLQ
ENGVLVPGRENEEVEGVKSEGAGKXAEEEEEEEEEDEEEGGAGRVELLQEVVPKEKVVPI
PEGSAFFCLSQTNSIRKACHTLIHHQIFTSLILVFIILSSVSLAAEDPIRAHSFRNHILG
YFDYAFTSIFTVXILLKMTVFEAFLHRGSFCCSWFNLLDLIVVSVSLISFRIHSRTISVV
KILQVLRVLRPLRAINRAKGLKHVVQCVFMAIRTIGNIMIVTILLQFMFACIGVQLFKGK
FYSCTDEAKHTPKECKGSFLIYLDGDVLRPLVRERLWVNSDFSFDNVLSAMMALFTVSTF
EGWPALLYKAXDAHAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFHAQGE
QEYQNCELDKNQRQCVEYALKAQPLCRYIPKNPHQYRVWATVNSATFEYLMFLLLLLNTV
ALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTFDALIVVGS
VVDIAITEVNNGGHLGESSEDSSRISITFFRLFQVMRLVKLLSKGERIRTLLWTLIKSFQ
AFPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINXNNNFQTFPQAVLLLFRCATGEVW
QEITLASLPGNRCNPESDVGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFD
YLTRDWSILGPHHLDEFKRIWSEYDPRAKGHIKHLDVVALLRYIQPPLGFGKLCPHRVAC
KRLVAMNVPLNSDGTVTFNATLFGLVQTSLKIKTEGNLKQAKQELXIVIKKIWKRIKQNL
LDEVIPPPDEEEVTVGKFYATFLIQDYFCKFRRRKXKGLLGTEAPTSTSSILQAGLRSLQ
DLGPEIRQALTYDTEEEEEEEAAGEKSEEEEAEKDPETYKASMDNQSQSQSLXCSRISVS
LPVKEKLPDLLSPGPSDDDGGAPNPKQPSALPAGSHTHRRSSGVLMFTIPEEGPKGTQGQ
DNQNEEEEVSDWLPYLDDPREISSNPGLLPPHWLQRQLNRHCIPQXRLLPPTPTGQKPSF
TIQCLQDNCEDLPIPGTYHHRRNSGPGRAQGSWVTPPQRGRLLYAPLLLVDEAAVGEGRL
GKTSAPLPTFTCLQVPGAHLNSGHGKRASADSLVEAVLISEGLGLFARDPRFVALAKQEI
ADACRLTLNKIDSAAGDLLAQGTTSLYSDEESILSHFDEEDLGDEMVCVHAL
NT seq 5739 nt   +upstreamnt  +downstreamnt
atgtcggaatctgaagacgggaaaggtgagagcagacatttacccctcctgtagaccctt
ggagccagcattgtggagtggaagccttttgacatcctcatcctgctgaccatctttgcc
aactgggtggccctgagggtatacatccccttccctgaggacgactccaacactgccaac
cacaatttggagcagatggaatatgtattcttggtgattttcaccgtggagacagtgctc
aagatcgtggcatacgggctggtactccaccctagcgcctacatccgcaatggctggaac
ctacttgacttcatcatcgtcgtggtctggctgtttagcgtgctgctggagcaaggacct
gggcagccaggtgatgccccgcatactggaggaaagccggggggcttcgatgtgaaggca
ttacgggcgtttagggtgctgcggccactgaggctggtatctggagtcccgagcctgcac
atagtgctcaattccatcatgaaggcgctagtaccgctgctgcacattgtgccgctagtc
ctcttcgtcattatcatctatgccatcatcggactcgagctgttcctcggacgcatgcac
aagacgtgctacttcctgggatcaggtatggaggcggaggaggatccatccccttgtgct
tcttctggctctgggcgttcatgcacactgaaccagactgagtgctgagggcactggcca
gggcccaatagtggcatcaccaacttcgacaattttttctttgccatgctgacagtcttc
cagtgtattaccatggaaggttggacagatgtcctctactggatgcaggatgccatgggg
tatgagctaccctgggtatacttcgtgagcctcatcatctttgggtccttctttgtcctc
aaccttgtgcttggtgtcctgagtggggagttctccaaggaaagagagaaggcaaaagca
cgaggtgactttcagaagcttcgggagaagcagcagatggaggaggaactgcatggctac
ctggactggattacacaggctgaagagctagactttgatgacccaacagcagatggcaac
ttgggttctctagctgaagaggacagggccggccatcggccccagctggctgagctgacc
aataggaggtgcggacgcctgcactggttcagtcactccacttgctccacacactccacc
agcagccatgctagcctcccagccagtgatacaggctccatggtggataccccaggcaat
gaggatgaagaggagggggctctggctggctgtacacactgcctaaacaagatcatgaaa
actaagatctgccatcacctccaccaagccaaccaatgtctccaagctggctgccgacgg
gctgtgaagtccaacgcctgttactgggctgtgctgctgctcgtcttcctcaacacactg
accattgcctctgagcaccatgggcagcctgtatggctcactcagacccaggagtacgcc
aacaaagtgctgctctgtctcttcaaggtggagatgcttctcaaactgtatggtctgggc
ccctctgcctatgtcgcctctttcttcaactgttttgactgctttgtggtctgtgggggc
atcctagaaaccactttggtggaagtgggtgtcatgcaaccccttggcatctcagtgctc
agatgtgtgcgcctcctcaggatcttcaagatcactagacactgggcatctctgagcaat
ctggtggaatccctgctcaattccatgaagtccatcacatccttgctgctcctcctcttc
ctctttatcatcattttttccctgcttagcatgcagctttttgggggcaagttcaatttt
gaccagacccacactaagcgaagcacctttgacacattcccccaagccctcctcactgtc
tttcagaccctgacaggtgaggattggaacgtggtcatgtatgatggcatcatggcttat
ggaggccccttcttcccagggatgctggtgtgtgtctatttcatcatcctcttcatctgc
tgcaactacatcctgttgaacgtctttcttgccattgctgtggataacctggccagcaga
gatgcaggcactgccaagaacaagggcagagagaagagcagagaaggaaaccctctacag
gaaaatggagtgttggtacctggtagagagaatgaggaagtggagggtgtaaagagtgaa
ggagcaggcaagtaggcggaggaagaggaggaagaggaagaagaggatgaggaggaaggt
ggagcagggcgtgtggaactcttacaggaagttgtacccaaggagaaagtggttcccatc
cctgagggaagtgccttcttctgcctcagccaaaccaactcgattcggaaggcctgccac
actctcattcatcatcaaatcttcaccagtctcatcctggtgttcatcatccttagtagc
gtgtccctggctgctgaggaccccattcgagcccactccttccgcaaccatattctaggg
tacttcgattatgccttcacctccattttcactgtgtagattctacttaagatgacagtg
tttgaggccttcctgcaccgtggctccttctgctgtagctggttcaatctgttggatctg
attgtagtcagtgtgtccctcatctcctttcgcatccactccaggaccatctcagtggtg
aagattctccaagtactcagagttctacggcccctcagagccatcaacagggccaaggga
ctcaagcatgtggtgcagtgtgtgttcatggcgatccggaccatcggaaacatcatgatc
gtcaccatcctcctgcagtttatgttcgcctgcatcggtgtgcagctcttcaaggggaaa
ttctacagttgcactgatgaggccaaacacaccccaaaagaatgcaagggttccttcctc
atctaccttgatggagatgtgttgcggcccttggtccgggagcggctctgggtcaacagt
gatttcagctttgacaatgttctttcagccatgatggccctgttcactgtttccaccttt
gaaggctggcctgcgctgctatacaaggccnntgatgcacatgcagaagatgagggccct
atctacaattaccatgtggaaatctctgtgttcttcattgtctacatcattatcattgct
ttcttcatgatgaacatctttgtgggctttgttatcatcacctttcatgcccaaggagag
caagagtaccaaaactgtgaactggacaaaaaccagcgtcagtgtgtggaatacgctctc
aaagcccagccactatgtcgatacatccccaagaatccacatcagtatcgtgtgtgggcc
actgtgaactctgccacctttgagtacctcatgtttctgctcctcctgctcaacacagtt
gccctagccatgcagcactatgagcagactgctccctttaactatgccatggatatcctc
aatatggttttcactggcctcttcactattgagatggtgctcaaaatcattgcattcaaa
cctaagcattactttgccgatgcctggaacacatttgatgctcttattgtggtgggcagc
gtagtagacattgccataacagaagtcaataatggaggccatcttggagagagttcagag
gacagctcccgaatatctatcaccttctttcgcctcttccaagtcatgaggctggtcaag
ctcctcagtaagggtgaaagaatccgaacattgctgtggacattgatcaaatctttccag
gcctttccctatgtggctcttctcatagcaatgatattcttcatctatgcagtcataggc
atgcagatgtttggcaaggtggctcttcaagatggcacacagatcaactgaaacaacaat
ttccagacctttccacaggctgtgctgcttctgttcaggtgtgccacaggtgaggtatgg
caagagataacgcttgccagccttcctggaaatcggtgtaaccctgaatctgacgttgga
ccgggtgaggaatttacctgtggtagtaattttgccattgcttattttatcagcttcttc
atgctctgcgccttcctgatcataaatctctttgtggctgtgatcatggataactttgat
tatctaaccagagattggtccatcctaggcccccatcaccttgatgaattcaagaggatc
tggtctgaatatgatcctcgagccaagggccacatcaagcacctggatgtagttgccctg
ctgagatacatccagcccccactgggatttggaaagctgtgcccacacagagtggcctgc
aagagacttgtggcaatgaacgtgcccctcaactcagatggaacagtgacattcaatgcc
acactctttggcctggtgcagacatccctgaagatcaagacagaagggaacctgaagcaa
gccaagcaggagctgtgaatagtcatcaaaaagatctggaagaggataaagcagaatttg
ttggatgaggtcatccctcctccagatgaggaagaggtcaccgtgggcaaattctatgct
acattccttatccaagattatttctgtaaattccggaggagaaaanaaaaagggctacta
ggaacagaggccccaacaagcacatcctctatccttcaggctggtctgaggagcctacag
gacctgggtcctgagatccggcaggccctcacctatgacactgaagaggaagaagaggaa
gaggcagcgggtgagaagagtgaggaggaggaagctgagaaggacccagaaacatacaaa
gcctccatggacaaccagtcccagtcccagtctctgtgatgctccaggatttcagtgtct
ctgcctgttaaggaaaaactcccagatttgctctcacctgggcccagtgatgatgatggt
ggggctcccaaccccaagcagcctagtgcgctcccggctggatcccacacccataggaga
agttctggggttctcatgtttactatcccagaagaaggacccaaggggactcaagggcaa
gacaatcagaatgaagaagaggaagtctctgactggctcccatacctggatgatccgaga
gagatttcctccaacccaggccttttgccaccccactggctgcagagacaattaaatagg
cactgtataccacaatgacgtttgctgccccccacacctacaggtcagaagccctccttc
accatccagtgtctgcaagacaattgtgaagacttgcccatcccaggcacctatcatcac
aggcggaactcaggacctggcagggctcagggttcctgggtaactcctcctcagaggggt
cggctactatatgcccccctgttattggtggatgaggctgcagtgggagaggggcgcctt
ggcaaaaccagtgcaccactgcccaccttcacctgtctgcaagtgcccggagctcacttg
aattccggtcacggcaagagggccagtgccgacagtttggtggaagctgtgctcatctct
gagggcctaggcctctttgcccgagacccacgcttcgtggccctggccaagcaggagatt
gcagatgcctgtcgcctgacactcaataagatagacagtgctgccggtgacctgctggca
cagggaaccacctcactctatagcgatgaggagtccatcctctcccactttgatgaagag
gacctgggagacgagatggtctgtgtccatgccctgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749025
Entry
103749025         CDS       T03372                                 

Gene name
Cacna1d
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04218  Cellular senescence
ngi04260  Cardiac muscle contraction
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04530  Tight junction
ngi04713  Circadian entrainment
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04727  GABAergic synapse
ngi04728  Dopaminergic synapse
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04929  GnRH secretion
ngi04930  Type II diabetes mellitus
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04973  Carbohydrate digestion and absorption
ngi05010  Alzheimer disease
ngi05020  Prion disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05031  Amphetamine addiction
ngi05410  Hypertrophic cardiomyopathy
ngi05412  Arrhythmogenic right ventricular cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749025 (Cacna1d)
   04020 Calcium signaling pathway
    103749025 (Cacna1d)
   04024 cAMP signaling pathway
    103749025 (Cacna1d)
   04022 cGMP-PKG signaling pathway
    103749025 (Cacna1d)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103749025 (Cacna1d)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103749025 (Cacna1d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103749025 (Cacna1d)
   04929 GnRH secretion
    103749025 (Cacna1d)
   04912 GnRH signaling pathway
    103749025 (Cacna1d)
   04921 Oxytocin signaling pathway
    103749025 (Cacna1d)
   04935 Growth hormone synthesis, secretion and action
    103749025 (Cacna1d)
   04924 Renin secretion
    103749025 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    103749025 (Cacna1d)
   04927 Cortisol synthesis and secretion
    103749025 (Cacna1d)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103749025 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    103749025 (Cacna1d)
   04270 Vascular smooth muscle contraction
    103749025 (Cacna1d)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103749025 (Cacna1d)
  09156 Nervous system
   04724 Glutamatergic synapse
    103749025 (Cacna1d)
   04727 GABAergic synapse
    103749025 (Cacna1d)
   04725 Cholinergic synapse
    103749025 (Cacna1d)
   04728 Dopaminergic synapse
    103749025 (Cacna1d)
   04726 Serotonergic synapse
    103749025 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    103749025 (Cacna1d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103749025 (Cacna1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103749025 (Cacna1d)
   05020 Prion disease
    103749025 (Cacna1d)
   05022 Pathways of neurodegeneration - multiple diseases
    103749025 (Cacna1d)
  09165 Substance dependence
   05031 Amphetamine addiction
    103749025 (Cacna1d)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103749025 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103749025 (Cacna1d)
   05414 Dilated cardiomyopathy
    103749025 (Cacna1d)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103749025 (Cacna1d)
   04934 Cushing syndrome
    103749025 (Cacna1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ngi04040]
    103749025 (Cacna1d)
Ion channels [BR:ngi04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103749025 (Cacna1d)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834
Other DBs
NCBI-GeneID: 103749025
NCBI-ProteinID: XP_008850050
LinkDB
Position
Un
AA seq 2177 aa
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGSLWCWWKRRGATKTGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNKPEANQTATSDNKVTIDDYREEDEDKDPYPPC
DVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHK
LINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTF
GAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGL
KHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFIL
YKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPV
YNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALK
ARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKVFNDAMDILN
MVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPTAT
PGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFI
YAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDP
DSDFNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLD
EFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGT
VMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTV
GKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQ
DDEPEESKPEEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDT
EKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENG
HHSSYKHDREPQRRSSIKRTRYYETYIRSESGDEQLPTICREDPEIHGYFRDSRCFGEQE
YFSSEECCEDDSSPTWSRQNYGYYNRYPGNSMDFERPRGYHHPQGFLEDDDSPIGYDSRR
SPRRRLLPPTPPSHRRSSFNFECLRRQSSQEEVLPSPALPHRAALPLHLMQQQIMAVAGL
DSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVERSESLDQVNGSLPSLHRSSW
YTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSAT
KHEIADACDLTIDEMESAASTLLNGSVCPRANGDVGPISHRQDYELQDFGPGYSDEEPDP
GREEEDLADEMICITTL
NT seq 6534 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcagcaagcggaccac
gcgaacgaggcaaactatgcaagaggcaccagactccctctttctggtgaaggaccaact
tctcagccgaatagctccaagcaaactgtcctgtcttggcaagctgcaatcgatgccgct
agacaggccaaggctgcccaaactatgagcacctccgcacccccacctgtaggatctctt
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtccaacagc
cgacctgcccgtgcccttttctgtttgtcactcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtcgagacatttttgaagatt
atagcatatggattattgctacatcctaatgcttacgttaggaatggatggaatttactg
gattttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggaaaatcagggggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccacttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccctctccttcacatcgcccttttggtattattt
gtaatcataatctatgctatcataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagacatcgtagctgaagaggacccagctccatgtgcgttctca
gggaatggacgccagtgtaccgccaatggcacagaatgtaggagtggctgggttggcccc
aatggaggcatcaccaactttgataactttgcctttgccatgctcactgtgttccagtgc
atcaccatggagggctggacagacgtgctctactgggtaaatgatgccataggatgggaa
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagagttctcaaaggaaagagagaaggctaaggcacgtgga
gatttccagaagcttcgcgagaagcagcagctggaagaggatctcaagggctacttggat
tggatcacccaggcagaagacatcgatcccgagaacgaggaggaggggggagaggaaggc
aaacgcaatactagcatgccgaccagtgagacagagtctgtaaacacagagaatgtaagt
ggtgaaggcgaaacccagggctgctgtggaagtctctggtgctggtggaaaagaagaggc
gcgaccaagactgggccctctgggtgtcggcggtggggtcaagccatttcaaaatccaaa
ctcagccgacgctggcgtcgctggaaccgatttaatcgcagaagatgcagggctgctgtg
aagtctgtcacgttttactggctggtgattgtcctggtgtttctcaacactttaaccatt
tcctctgagcactacaatcagccagattggctgacgcagattcaagatattgcgaacaaa
gtcctcttggctctgttcacctgcgagatgctggtaaaaatgtacagcttgggtctccag
gcatatttcgtctctctcttcaaccggtttgattgcttcgtggtgtgtggcgggatcact
gaaaccatcctggtggagctggagatcatgtctcctctgggcatctctgtgtttcggtgc
gtgcgtctcctgagaatcttcaaagtgaccaggcactggacttccctgagcaacctggtg
gcgtccttgttaaactccatgaagtccatcgcttcactgctgctgctgcttttcctcttc
atcatcatcttctccctgctgggaatgcagctgtttggtgggaagtttaattttgatgaa
acacaaaccaagagaagcacctttgacaacttcccgcaagccctgctgactgtgttccag
atcctgacaggtgaagactggaacgcagtaatgtatgatggcatcatggcttatggaggc
ccatcctcttccggaatgatcgtctgcatctacttcatcatcctctttatctgtggcaac
tatattctactgaatgtcttcttggccatcgctgtagacaatttggctgatgctgaaagt
ctgaacactgctcagaaagaggaagctgaagaaaaggaaaggaaaaagattgccagaaaa
gaaagcttggaaaataaaaagaacaaaccagaagccaaccagacagccaccagtgacaac
aaggtcacaattgatgactatcgggaggaggatgaagataaagacccttacccaccctgt
gatgtgccagtaggtgaagaggaagaggaggaggaggaagatgagcctgaggttcctgct
ggtcctcgtcctcgaagaatctcggagttgaacatgaaggagaaaattgcacccatccct
gaaggaagcgctttcttcattcttagcaagaccaacccgatccgtgtgggctgccacaag
cttattaaccaccacatcttcaccaacctcatcctggtcttcatcatgctgagcagcgct
gcccttgccgctgaggaccccatacgcagccactcgttccggaacactatactgggttac
tttgactatgcattcacagccatctttactgttgagatcctgttgaagatgacaaccttt
ggcgctttcctgcacaaaggggctttctgcaggaactattttaacttgctggacatgctg
gttgttggagtgtctctggtgtcatttggaattcaatccagtgccatctccgttgtgaag
attctgagggtcttaagggtcttgaggcccctcagagcaatcaacagagcgaaaggactt
aagcacgttgtccagtgcgtcttcgtggccatccggacgatcggcaacatcatgatcgtc
accaccctgctccagttcatgtttgcgtgcattggggtccagttgttcaagggaaagttc
tatcgctgcacagatgaggccaaaagcaacccggaagaatgcaggggtcttttcattctt
tacaaggatggggatgttgacagtcctgtggtccgtgagaggatctggcaaaatagtgat
tttaattttgacaacgtcctctctgctatgatggcactcttcacggtctccacttttgag
ggctggcctgctttgctgtataaagccatcgactcaaatggagagaacattggccccgtc
tacaactaccgcgtggagatctccatcttcttcatcatctacatcatcatcgttgccttc
ttcatgatgaacatctttgtgggcttcgtcatcgtcacctttcaggagcagggagaaaaa
gagtacaagaactgtgagctggacaagaatcagcgtcagtgtgttgaatacgccttgaaa
gcacgccccttgcggagatacatccccaaaaacccctaccagtacaaattctggtacgtg
gtgaactcctcaccttttgaatacatgatgttcgtcctcatcatgctcaacacactctgc
ctggccatgcagcactatgagcagtccaaggtgttcaatgatgccatggacattctgaac
atggtcttcacaggggtgttcactgtcgagatggttttgaaagtcattgcatttaagccc
aaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagcatt
atagacgtggccctcagcgaagccgacccaactgaaagtgaaaatgtcccaactgccaca
cctgggaactccgaggagagcaatagaatctccatcacctttttccgtcttttccgagtg
atgcgactggtgaagcttctcagcaggggggaaggcatccggacattgctgtggactttc
attaagtcctttcaggctctcccatatgttgccctgctcatcgccatgttgttcttcatc
tacgcagtcattggcatgcagatgtttggaaaagtggccatgagagataacaaccagatc
aataggaacaacaacttccagacgtttccccaggcagtgctgctgctcttcagatgtgcg
acaggggaagcctggcaggaaatcatgcttgcctgcctcccaggaaaactgtgtgacccg
gattcagatttcaaccctggagaggaatacacttgtgggagcaactttgccatcgtctat
ttcatcagcttttatatgctctgtgcattcctgatcatcaacctctttgtggctgtcatt
atggacaattttgactatctaaccagggactggtctattctgggacctcaccacttggat
gaattcaaaagaatatggtcagaatatgaccctgaagcaaagggaaggataaagcacctc
gatgtggtcactctgctccgacgcatccagcctcctctggggtttgggaagttatgtcca
cacagagtagcgtgtaagagattagttgccatgaatatgcctctcaacagtgatggaaca
gtcatgttcaatgctaccctgtttgctttggtccgaacagctctcaagatcaagactgaa
gggaacctggagcaagctaatgaagaactccgagctgtaataaagaaaatctggaagaag
accagcatgaagctgcttgaccaagttgtccctccagctggtgatgatgaggtaaccgtg
gggaagttctatgccactttcctgatacaggactactttaggaaattcaagaaacggaaa
gagcaaggcctggtgggaaagtaccctgcgaagaacaccacaatcgccctacaggcagga
ttaaggactctgcatgacattgggccagaaatccgccgtgctatatcctgtgacttacaa
gatgatgagccagaagaatcaaagccagaagaagaagatgtattcaaaagaaatggtgcc
ctgcttggaaaccatgtcaatcatgttaatagtgataggagagattcccttcagcagacc
aataccacccaccgtcccctgcatgtccaaaggccttcaattccacctgcaagtgatact
gagaaaccgctgtttcctccagcaggaaattcggtgtgtcataaccatcataaccataat
tccataggaaagcaagttcccacctcaacaaatgccaatctcaataatgctaatatgtcc
aaagctgcccatggaaagcggcccagcattgggaaccttgagcatgtttctgaaaatggg
catcactcctcctacaagcatgaccgggagcctcaaagaaggtccagtattaaaagaacc
cgctattatgaaacttacattaggtctgaatcaggagatgaacagcttccaactatttgc
cgagaagaccctgagatacatggctacttcagggactcccgctgcttcggggagcaggag
tatttcagtagtgaggaatgctgtgaagatgatagctctcccacctggagcaggcaaaac
tatggctattacaacaggtacccaggcaactccatggattttgagagaccccgaggctac
catcacccccaaggcttcttagaggatgatgactcacccattggctatgattcaaggaga
tctccgaggagacgacttctacctcccaccccaccatcccatcggagatcctccttcaac
ttcgagtgtctgcgccggcagagcagccaggaagaggtcctgccatcgcctgcactgccc
caccgtgctgccctgcctctgcacctgatgcaacagcagatcatggctgtcgcaggcctc
gattccagtaaagcccagaagtactcaccaagccactccacccggtcatgggccacgcct
ccggcgacccctccatacagggactggaccccatgctacacccccctgatccaggtggaa
cgctcagagtccctggaccaggtcaatggcagcctgccatccctgcaccgcagttcctgg
tacacagatgagcccgatatctcctataggactttcacaccagccagcctgactgttccc
agtagcttccggaacaaaaacagcgacaagcaaaggagtgcagacagcctggtagaggca
gtcttgatatccgaaggcttaggacgctacgcaagggacccaaaatttgtgtcagcaaca
aaacacgaaatcgccgatgcctgtgacctaaccatagacgagatggagagtgcagccagc
actctgctcaatggtagtgtgtgtccacgagccaatggggacgtaggtcccatctcacac
cggcaggactacgagctacaggactttggtcctggctacagcgacgaggagccagacccc
gggcgagaggaggaggacctggcagacgaaatgatctgcatcacaaccttgtag

DBGET integrated database retrieval system