KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732179
Entry
103732179         CDS       T03372                                 

Gene name
Pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00562  Inositol phosphate metabolism
ngi01100  Metabolic pathways
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04371  Apelin signaling pathway
ngi04611  Platelet activation
ngi04725  Cholinergic synapse
ngi04921  Oxytocin signaling pathway
ngi05132  Salmonella infection
ngi05145  Toxoplasmosis
ngi05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103732179 (Pik3cg)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103732179 (Pik3cg)
   04072 Phospholipase D signaling pathway
    103732179 (Pik3cg)
   04022 cGMP-PKG signaling pathway
    103732179 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    103732179 (Pik3cg)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103732179 (Pik3cg)
   04062 Chemokine signaling pathway
    103732179 (Pik3cg)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103732179 (Pik3cg)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103732179 (Pik3cg)
  09156 Nervous system
   04725 Cholinergic synapse
    103732179 (Pik3cg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103732179 (Pik3cg)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103732179 (Pik3cg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103732179 (Pik3cg)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103732179 (Pik3cg)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103732179 (Pik3cg)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 103732179
NCBI-ProteinID: XP_008828950
LinkDB
Position
Un
AA seq 1102 aa
MELENYEQPVVLREDNLRRRRRMKPRSAVGSLSSMELIPIEFVLPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVMADFYHRMGPDNFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHKSPGQIHVVQRHGPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDARLYAMHPWVTSKPLPDYLSKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILQSFFAKMAKKKSLMNIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDSPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFGIKI
KDLPKGALLNLQIYCGKAPALSGKASAETQGSESKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKAEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQRVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTVLSNETIGIIFKHGDDLRQ
DMLILQILRIMETIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPYFQKFQDVCVRAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEGDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaattatgagcagccggtggttctgagagaagacaacctccgccggcgt
cggaggatgaagccacgcagtgcggtaggcagcctgtcctccatggagctcatccccatt
gagttcgtgttgcccaccagccagcgcatcagcaagactccagagactgcgctgctgcac
gtggcaggccacggcaatgtggagcagatgaaagcccaggtgtggctgcgcgccctggag
accagcgtgatggcggacttctatcaccggatgggcccagacaacttcctcctgctctac
cagaagaagggacagtggtacgagatctacgacaagtaccaggtggtgcagaccctagac
tgcctgcgctactggaaggtgctgcacaagagcccaggtcagatccacgtggtgcagcga
cacgggccttcggaagagaccctggccttccagcggcagctcaccgccctgattggctat
gatgtcactgatgtcagcaacgtccacgatgacgagctggagttcacacgccgccgtctg
gtcacacctcgtatggccgaagtggctggccgtgacgccaggctctatgccatgcacccc
tgggtgacgtccaagcccctcccagactacctgtctaaaaagattaccaataattgcatc
tttatcatcatccaccgcagcaccaccagccaaaccatcaaggtctctgcagatgatact
cccggcaccatcctccagagcttctttgccaagatggccaagaagaagtcactaatgaat
atcccggaaagccaaaatgagcaggatttcgtgctgcgggtctgtggccgggatgagtac
ctggtgggtgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaatgga
gaggagattcacctggtacttgacagtcctccagacccagctctggatgaggtgaggaaa
gaagagtggccactggtggatgactgcactggagtcaccggctaccatgagcagctgacc
atccacggcaaggaccatgagagcgtgttcacagtgtccttgtgggactgtgaccggaag
ttcagggtcaagatcagaggtattgatatccccgtcctgccccggaacactgacctcact
gtttttgtggaagcaaacatccagcatgggcagcaagtcctttgccaaaggagaaccagc
cccaagcccttcaccgaagaggtgctttggaacgtttggcttgagttcggcatcaaaata
aaagacttgcccaaaggagcgctactgaacctccaaatctactgtggcaaagctccagca
ctgtctgggaaggcctctgcagagactcagggttcagagtccaagggcaaagcccaactt
ctctattatgtgaacttgctgctgatagaccaccgcttcctcctgcgccacggagaatac
gtgctccacatgtggcagatatctgggaaggcagaagaccaagggagcttcaatgctgac
aagctcacttctgcaacaaacccggacaaagagaactcaatgtccatctccatcctgctg
gacaactactgtcaccccatagccctgcctaagcatcggcccacccctgatcctgaaggg
gaccgagttcgcgctgaaatgcccaatcaacttcgcaagcaattggaagcgattatagca
actgatcctcttaaccccctcacagcagaggacaaagaattgctctggcattttcgatat
gaaagcctgaagcatccaaaagcataccctaagctatttagctcagtgaaatggggacag
caagaaattgtggccaaaacctatcaactgttagccagaagggagatctgggatcaaagt
gctttggatgttggcttaactatgcaactcttggactgcaacttttcagatgaaaatgta
agagctattgcagttcagaaactggagagcttggaggatgatgacgttttacattacctt
ctccagctggtgcaggctgtgaagtttgaaccataccatgacagtgcactggctagattc
ctgctgaagcgtggcttgagaaacaaaagaattggccatttcttgttctggttcttgagg
agtgagatagcccagtccagacactatcagcagaggtttgcagtgatcctggaagcatat
ctacggggatgtggcacagccatgctgcacgacttcacccagcaggtccaagtgattgag
atgttacagagagtcaccattgatattaaatcactgtctgctgagaagtatgacgtcagt
tcccaagttatttcacaacttaagcaaaagcttgaaaacctgcagaattccaatctcccc
aagagctttagagttccctatgatcctggactgaaagcaggtactttggtgattgaaaaa
tgtaaagtgatggcatccaagaaaaagcccctgtggcttgagtttaaatgtgctgatcct
acagtcctgtccaatgaaacaattggaattatctttaaacatggtgatgatctgcgccaa
gacatgctgatcttacagattctgcgaatcatggagactatttgggagactgagtctctg
gatctgtgccttttgccgtatggttgcatctccacaggtgacaaaataggaatgatcgag
attgtgaaagatgccacaacaattgctcaaattcagcaaagcacagtgggcaacacgggt
gctttcaaagatgaagttctgaatcactggctcaaggaaaaatgccctattgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaacgttt
gttcttggaataggtgacagacacaacgacaacattatgatctcagagacaggaaactta
tttcatatagactttggacacattcttgggaattacaaaagcttcttgggcattaataaa
gagagagtgccatttgtgctaaccccagacttcttgtttgtgatggggacttctggaaag
aagacaagcccatacttccagaaatttcaggatgtctgtgttcgggcttatctagcgctc
cgtcatcacacaaacctgttgatcatcttgttctccatgatgctgatgacaggaatgccc
cagttaacaagcaaagaagacatagaatatattcgggatgctctcaccgtggggaaaaat
gagggggatgctaagaaatattttcttgatcagattgaagtttgcagagacaaaggatgg
actgtgcagtttaactggttcctgcatcttgttcttggcatcaagcaaggagagaaacat
tctgcttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752079
Entry
103752079         CDS       T03372                                 

Gene name
Pik3r5
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04371  Apelin signaling pathway
ngi04611  Platelet activation
ngi04725  Cholinergic synapse
ngi04921  Oxytocin signaling pathway
ngi05145  Toxoplasmosis
ngi05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103752079 (Pik3r5)
   04072 Phospholipase D signaling pathway
    103752079 (Pik3r5)
   04022 cGMP-PKG signaling pathway
    103752079 (Pik3r5)
   04151 PI3K-Akt signaling pathway
    103752079 (Pik3r5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103752079 (Pik3r5)
   04062 Chemokine signaling pathway
    103752079 (Pik3r5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103752079 (Pik3r5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103752079 (Pik3r5)
  09156 Nervous system
   04725 Cholinergic synapse
    103752079 (Pik3r5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103752079 (Pik3r5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103752079 (Pik3r5)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103752079 (Pik3r5)
SSDB
Motif
Pfam: PI3K_1B_p101 Sporozoite_P67
Other DBs
NCBI-GeneID: 103752079
NCBI-ProteinID: XP_008853961
LinkDB
Position
Un
AA seq 876 aa
MLPGATTCTEDRIQHALERCLHGLSLGRCSAPWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHCFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRRHRSSTITVLLLNPVEVQAEFLAVAD
KLSTPGQSPHSAYTTLLLHAFQATFGAHCDLPSLHHRLQSKTLEELENIFTETTEAQELA
SGIGDVAEARQWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWNQDSFDI
LQEILLKEQELQPGILGDDEDEEEEEEEEEDLETDQHCAERDSLLSTSSLASHDSTLSLT
SSQASGSTLSSQVLTTFVSGLSDGMDSGYVEDNEESSSEWTKRPGSREHRGHRRPGQKFN
RIYKLLKNTSQLVLRRDSRSLESSPDPTLPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQP
KLSTQLPSWLQAPPSRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLE
NSHPLLTRFFKLQFFYVPVKQSHGTSSGACPSPVNRTSPLPADSLRHTNPAELGTTPWED
STNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSAAKLPILADMLLYY
CRFAARPVLLQVYQTELTFITGDKTTEIFINSLELGHSAATRAIKASGPGSKRLGIDDDR
EAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACQKLEELDSSMEALTLTLTEVVK
RQNPKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDDRKILQSVVRCEVSPCYKPE
KSGLPPQRPFGQPAQAGPDLCSLLCLPIMTFSGALP
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgctgccaggggccacgacgtgcacggaggaccgcatccagcatgccctggagcgctgc
ttgcacggactgagccttggccgctgctctgctccctggtcagccgggctttgtctgaac
tgttggagcctacaggagctagtcagcagggacccaggccacttcctcatcctcctggag
cagatcctgcagaagacccaagaggttcaagaaaagggcacctatgacctcctcgcccca
ctggctctgctcttctattcaactgtcctttgtacaccacactttccaccggactcagat
ctccttctgaaggcagccagaacctaccactgcttcctgacctggccagttccctactgc
agcatctgccaggaactgctcaccttcattgatgccgaactcaaggccccagggatctcc
taccagcggctggtgagggctgagcagggcctgcccatcaggagacaccgaagttctaca
atcactgtgttgttgctgaacccagtggaggtacaggcagaatttctcgctgtggcagac
aagttgagcactcctggacagtcaccccacagtgcctacaccaccctgctcctgcatgcc
ttccaggccacttttggggcccactgtgacctccccagcctgcaccataggcttcagtcc
aagacactggaagagcttgaaaacatcttcacagagacgacagaagcccaggaactggca
tctggcatcggggatgttgcagaggcccggcagtggcttcggaccaagctgcaagcagtg
ggagaaaaagcgggcttccctggggtcttagacactgcaaaacctgggaaactccacaca
atccccatccctgtcgccaggtgctacacctacagctggaaccaggacagctttgacatt
ctacaggaaatcctcctcaaggaacaggaactacagccagggatcctaggagatgatgaa
gatgaggaggaagaggaggaggaagaggaggatttggagacagatcagcattgtgctgag
agagactcgctgctctccaccagctctctggcatctcacgactccactctgtcactcacc
tcctcccaggcctcagggtcaacactctccagccaggtgttgaccaccttcgtctcaggt
ctctcagatggcatggacagtggctatgtggaggacaatgaggagagttcctcagagtgg
accaagaggcctggcagccgggaacacaggggccaccgcaggccagggcagaagttcaac
aggatctataaactcttgaagaacaccagccagctggtcttgcgaagggactctcggagc
ctggagagcagtccagacccaactctgcccctgcggcgggcaggaagcctctgcagcccc
ctggactgtccagctcagctcccttcccgggcccagcgctctcgctccctgcctcagccc
aagctcagtacccagctgcccagctggctccaagcacccccctcacgccaccaacgccgc
cgccccttcctcagtggggatgaagaccccaaggcttccacactacgggttgtggtcttt
ggttctgatcggatttcagggaaggtggctcgggcatatagcaagctccggaggctggag
aacagtcacccactcctcacacggttcttcaagcttcagttcttctatgtgcctgtgaag
caaagccatgggaccagctctggtgcctgcccatcccctgtgaaccggacgtccccactc
cctgctgactccctgaggcacactaaccctgcagagctgggcacaaccccatgggaggac
agtaccaatgacatctctcactacctcggtatgcttgacccctggtatgaacgcaatgtg
ctgggcctcatgcacctgcctcctgaagtcttgtgccagcagtccctgaaggcagagtcc
agacccctggagggctccgcagccaagctgcccatcctggccgacatgctgctctactac
tgccgctttgctgcccgcccagttctgctgcaggtctaccagacagagctgaccttcatc
actggggacaagaccacagagatcttcattaactctctggagctgggtcactcggctgcc
acacgggctatcaaggcttcaggtcctggcagcaagaggctgggcattgatgacgaccga
gaggccgtccctctaacactacagattatttacagcaagggagccatcagtgggcgaagc
cgttggagcaacctggagaaggtctgtacctctgtcaacctcaacaaggcctgccagaag
ctggaggagctagactccagcatggaggccctgacgctaaccctgacagaagtggtgaaa
agacagaaccccaagtccaaaaagggctttaaccagattagcacgtcccagatcaaagtg
gacaaagtgcagatcatcggctccaacagctgtccctttgctgtgtgtctggaccaggat
gacaggaagatcctgcagagtgtggtcaggtgcgaagtatcaccctgctacaagccagag
aagagtggtctgccgccccagaggccctttggtcagccagcacaggctgggcctgacctg
tgctcccttctctgcctccccataatgactttcagtggagctctcccctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752080
Entry
103752080         CDS       T03372                                 

Gene name
Pik3r6
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04371  Apelin signaling pathway
ngi04611  Platelet activation
ngi04725  Cholinergic synapse
ngi04921  Oxytocin signaling pathway
ngi05145  Toxoplasmosis
ngi05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103752080 (Pik3r6)
   04072 Phospholipase D signaling pathway
    103752080 (Pik3r6)
   04022 cGMP-PKG signaling pathway
    103752080 (Pik3r6)
   04151 PI3K-Akt signaling pathway
    103752080 (Pik3r6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103752080 (Pik3r6)
   04062 Chemokine signaling pathway
    103752080 (Pik3r6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103752080 (Pik3r6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103752080 (Pik3r6)
  09156 Nervous system
   04725 Cholinergic synapse
    103752080 (Pik3r6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103752080 (Pik3r6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103752080 (Pik3r6)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103752080 (Pik3r6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 103752080
NCBI-ProteinID: XP_017650496
LinkDB
Position
Un
AA seq 761 aa
MESSDVELDLQRSVQAVLRELNTPNPALQRNQGMWRWSLHKKVERDPGKNSVLVRILLRE
LEKAESEDVRHVIIPLLLTLMYVLTKATGITEELYQRTYTFCTRLLTLPAPYSTVALDCA
IRLKTETAVPGTLYQRTVIAEQNLMSELYPYQERVLLFVDPELVSASVCSALLLEIEAAQ
EQQTPEVCMRHVVSHALQATLGEACHTGALHRKLQASSRRVLEYYFHAVVAAMEQVASDD
YPRRLGHLERLKEIHCSLIGPAARDRGSGKHCSFFSGDPLQDRLPSIPLPSPYITFHLWT
DQEQLWKELVLFLRPHSQLRLSADLEALDLQGLRPDRDLARVSMLSTDSGIERDLPLGAD
ELPAPSSPEMERASLQRKGGIKKRVWPPHFSMPGSWDGTPGLHRRTGRPSGDGELLPGVS
RVHTARVLVLGDDRMLGQLAQAYHRLRKRETKKFCLTPRLSLQLYYIPVLAPQGPTASRK
LELGELASFLGQVDPWYASTVNTLCPAILKLAEMPPCLDTSRSVDPFILDVITYYVRMGT
QPIYFQLYRVKIFTDLSQDPTEDIFLTELKVKIQDSKSLKEGSSPWKRGAAEGQGAELSI
CYQKALLSHRPREVTVSLRATGLVLKAIPADDTEVSGFSHGSPNAASVTDHTCLHVSVTE
VVKSSNLAGRSFPSATNTFRTSSIHVQSQDQRLLTLWLDKDSRRTFRDVVRFEADPCPEP
CSRAQKYKTSGLNSHGQETERTVERPKPLLMPINTFSGIIH
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggagagttcagatgtggagctggacctgcagaggagtgtgcaggctgtactgcgagag
ctcaatacgccaaacccagccctgcagagaaaccaaggcatgtggagatggtcactgcac
aagaaagtggagcgagatcccggaaagaactccgtgctggtccgaattctgctcagggag
ctggagaaggcagaaagtgaggacgtgcggcatgtcatcatccccttgctgctcactcta
atgtacgtgctcactaaggccacaggtatcacagaagagctctaccagagaacatatacc
ttctgtaccaggctgctgaccctgcctgccccctattctacagttgctttggactgtgcc
ataaggctgaaaacagagacagctgtcccaggcacgctgtaccaaaggacagtcattgct
gagcagaacctgatgagtgaactgtacccttaccaggagagagtactcctgtttgtggat
cctgagctggtttctgcctccgtgtgcagcgccctgttgctggagattgaggcagcccag
gagcagcaaacaccagaggtctgcatgcgacacgttgtctcccatgccctgcaggcaact
ctgggggaagcctgccatacaggtgctctgcacaggaagctgcaggccagctcccgtcgc
gtcctggagtactatttccacgcagtagtggctgccatggagcaggtggctagcgatgac
taccccaggcggctgggacatctggaaaggctaaaagagattcactgctcgctgatagga
ccggccgcgagggaccgtggcagcggtaagcactgctcttttttttcaggcgaccctctc
caagaccgactgccaagcatccctctgcccagcccctacattaccttccacctgtggacg
gaccaggagcagctctggaaagaactggtgctcttccttcgtccacattcccagctacgc
ctcagcgctgacttggaggctttggatctacaaggcctcaggccagaccgggacttggcc
cgggtgtctatgctatccactgacagtggtattgagcgggatcttcctttgggagccgat
gagctcccagcccctagcagccccgagatggagcgggcttcactgcaacgcaagggaggc
atcaagaagcgtgtgtggcccccccacttctccatgcctggcagctgggatgggacccca
gggctgcaccggagaactggcaggcccagtggggatggggagctgcttcctggtgtctcc
cgggtgcatacagcccgtgtgctggtgctgggggatgacaggatgctggggcaattggcc
caggcctaccacagactcaggaaacgggagaccaagaagttctgcctcactcccagactc
agcctgcagctttactacatcccggtgctggcacctcagggacccacagcatccagaaag
cttgagctgggagagctggcctcctttctgggccaagtggacccatggtatgcaagcacc
gtcaacaccttgtgtcctgccatcctcaagctggctgagatgcctccctgtctggacaca
tcccggagtgtggacccttttatccttgatgtcatcacttactatgttcgcatgggcacc
caacccatctatttccagctttacagagttaagatcttcacagacctgagtcaagaccct
acagaggacattttccttacagagctgaaggtgaagatccaagactccaagtccctcaaa
gagggctcttcaccctggaagagaggggcagctgagggtcaaggtgccgagctgtccata
tgctaccagaaggctctgctcagccataggcctcgagaggtcactgtttccctgcgggcc
actgggctggtcctgaaggccattccagctgatgatacagaagtttcagggttctcccat
ggctccccgaatgctgcttctgttacagaccacacatgtcttcatgtcagtgtaaccgag
gttgtcaagtcctccaacctggcgggaaggtcattcccttcagcgacaaacaccttccgg
acatccagtatccatgtccagagccaggaccagaggctactgacactgtggctagacaag
gacagtcgacgcactttcagggatgtggtcagatttgaagctgatccctgcccagagcca
tgttcccgagcccagaaatacaagacatcagggctcaattcacatgggcaggaaacagaa
aggaccgtggagaggcccaaaccccttcttatgcctatcaacacattctctggcatcatc
cattga

DBGET integrated database retrieval system