KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732421Help
Entry
103732421         CDS       T03372                                 

Gene name
Lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03030  DNA replication
ngi03410  Base excision repair
ngi03420  Nucleotide excision repair
ngi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103732421 (Lig1)
   03410 Base excision repair
    103732421 (Lig1)
   03420 Nucleotide excision repair
    103732421 (Lig1)
   03430 Mismatch repair
    103732421 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ngi03032]
    103732421 (Lig1)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103732421 (Lig1)
Enzymes [BR:ngi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103732421 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103732421 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103732421 (Lig1)
DNA replication proteins [BR:ngi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103732421 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103732421 (Lig1)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103732421 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     103732421 (Lig1)
   MMR (mismatch exicision repair)
    Other MMR factors
     103732421 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 103732421
NCBI-ProteinID: XP_008829215
LinkDB All DBs
Position
Un
AA seq 983 aa AA seqDB search
MQRSIMSFFQPSKEGKAKKLEKETPKNTREKEPPPKVALKERNGVVPESDSPVKRPGRKV
AQVLSSEGEEEDEALATPKGQKLLSDSSPSPDTCPENSPFLASSPPMDVSPSGFPKRRTA
RKQLSKRTNQDVLKDQKEDKDREAKKRKTEETETPRENLTEAKEVKQKDDEGDQATPGSE
PTTPPKTPKTPIRKQLLKRMNRDVLEEQKEEKDRGTKKRKKEEAEIPSLTETKEAKQKEE
EEGDKPTTPPETLKTPKAVTLAKKEKVPVSKASGKQEPQEEEQSKPPARGARTLNSFFIP
RKPAAKSEVKQEESSTPRKEETKGALNPTGYNPAKNNYHPIEDACWKVGQKVPFLAVART
FEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLTLNRLGPPQQGLELGVGDGVLL
KAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTTSGVFSKFRDIARLT
GSASMAKKMDIIKGLFVACRHSEARFIARSLSGKLRLGLAEQSVLAALAQAVSLTPPGQE
FPPPVVDVGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLEHLPEHCKLS
PGVPLKPMLAHPTRGVGEVLKRFEEADFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNT
GKYPDIISRIPKIKLPSVASFILDTEAVAWDREKKQIQPFQVLTTRKRKDVDASEIQVQV
CLYAFDLIYLNGESLVRQPLSRRRQLLRENFVETEGEFVFATSLDTKDTEQIAEFLEQSV
KDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRY
GGFLLAAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRIDGAVAPDHW
LDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKKPEEATTSAQVAC
LYRKQSQIQNQQSSGSDSDPEDY
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtagtatcatgtcattttttcaaccttcaaaagagggtaaagcaaagaagctg
gaaaaggagacccccaagaacaccagagagaaggagccccctccaaaggtggcactgaag
gagaggaatggagtggtacctgagagtgactctccagtgaagaggccagggaggaaggtg
gcccaggtcctcagcagcgaaggggaggaagaagatgaagcccttgccacccccaaaggc
cagaaacttctttcagactcttcccccagccctgacacatgtcctgagaacagccctttc
cttgccagcagtcctcccatggatgtgtccccatcagggttcccgaagcgtcgcacagct
cggaagcagctgtcaaaacggacaaatcaggatgttttgaaagatcagaaagaggacaaa
gacagagaagccaagaagaggaagacggaagaaacagagaccccaagggaaaacctcaca
gaggccaaagaggtaaaacagaaggacgatgagggcgaccaagccacaccaggctctgag
cctacaacaccacctaagaccccaaagacccccattcggaagcagctcctgaaacggatg
aatcgggatgttctggaagagcagaaagaggaaaaggacagaggaaccaagaaaaggaag
aaggaagaagcagagattccaagccttacagagaccaaagaggcaaaacagaaggaagaa
gaggagggggacaagcccacgacaccacccgagaccctaaagacccccaaagcagtgacc
ctggcaaagaaagaaaaggttccagtatccaaggccagcgggaaacaggagcctcaggaa
gaggagcagagcaagcctcctgccagaggggctcggacgcttaacagcttctttatcccc
cggaaaccagcagccaagtctgaagtgaaacaagaggagtcgagtactccaaggaaggag
gagaccaagggagccctcaacccaacaggctacaatcctgccaagaacaactatcatccc
atcgaagatgcttgctggaaagtcggccagaaggtcccttttctcgctgtggcccggaca
tttgagaagattgaggaggtttctgctcggctcaggatggtggagaccctgagcaacctg
ctgcgttccgtggtggccctgtcgcctccagacctgctccctgtcctctacctcactctc
aaccgcctcgggccaccccagcagggactggaactgggcgttggtgatggtgtcctcctc
aaggcagtggcccaggccacaggtcggcagctggagtcagtccgagctgaggcagctgag
aagggcgacgtggggctggtggcagagaacagccgcagtacccagagactcatgctgccc
ccacccccgctcaccacctcgggggtcttctccaaattccgagacatcgccaggctcact
ggtagtgcttccatggccaagaagatggacatcatcaagggcctgtttgtcgcctgccgc
cactcagaagcccggttcattgccaggtccctaagtggaaagctacgccttgggttggct
gaacagtcggtactggccgcccttgcccaggctgtgagccttacaccccctggtcaagaa
tttcccccacctgtggtggatgttggaaagggcaagacagcagaggccagaaagacatgg
ttggaggaacaaggcatgatcttgaagcagaccttctgtgaggtgcccgatctggatcga
attgtccctgtgttgttggaacatggcctggaacatctgccagagcactgcaagctaagc
ccaggggtccctctgaaaccgatgctggcccatcccactcgtggtgttggtgaggtcctg
aaacgctttgaggaggcagatttcacctgcgagtacaaatacgacggacagcgggcacag
atccatgttctagaaggtggagaggtaaagatcttcagcaggaaccaggaggacaacaca
ggaaagtaccccgacatcatcagtcgcatccctaagatcaaactcccctcagtcgcatct
ttcatcctggacactgaagctgtggcctgggaccgggagaagaagcagatccagccattc
caagtgctcaccactcgcaaacgcaaggatgttgatgcatcagagatacaagtgcaggtg
tgtttatatgccttcgacctcatctacctcaacggagagtccctggtccgacagcccctg
tctcgccgccggcagctgctccgggagaactttgtggagacagagggtgagtttgtcttc
gccacctccctggataccaaggacactgagcagattgctgagttcttggagcagtcagtg
aaagactcctgcgaggggctgatggtgaagaccctggatgtcgacgccacgtacgagatt
gccaagaggtcacacaactggctcaagctgaagaaggactaccttgatggtgtcggcgac
accctggaccttgttgtaatcggcgcctatctgggccgggggaagagggctggccggtac
gggggcttcctgttggccgcctacgacgaggagagtgaggagctgcaggccatatgcaag
cttggaactggattcagtgatgaggagctggaagaacatcaccagagcctgcaggccctg
gtgctgcccaccccacgcccatatgtgcgcattgatggagccgtggcccctgaccactgg
ctggacccaagtgctgtgtgggaggtgaagtgcgctgatctctccctgtcccccatctac
cccgctgcacggggcctggtggacagtgacaaagggatctcccttcgcttccctcggttc
attcgtgtccgtgaagacaagaagccagaggaggccaccaccagtgcccaggtggcctgc
ctgtaccggaagcaaagtcagattcagaaccagcaaagctcaggctcggattccgaccct
gaagattactaa

DBGET integrated database retrieval system