KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732646
Entry
103732646         CDS       T03372                                 

Gene name
Dvl3
Definition
(RefSeq) dishevelled segment polarity protein 3
  KO
K02353  segment polarity protein dishevelled
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04330  Notch signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103732646 (Dvl3)
   04330 Notch signaling pathway
    103732646 (Dvl3)
   04390 Hippo signaling pathway
    103732646 (Dvl3)
   04150 mTOR signaling pathway
    103732646 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103732646 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103732646 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732646 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103732646 (Dvl3)
   05226 Gastric cancer
    103732646 (Dvl3)
   05217 Basal cell carcinoma
    103732646 (Dvl3)
   05224 Breast cancer
    103732646 (Dvl3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103732646 (Dvl3)
   05022 Pathways of neurodegeneration - multiple diseases
    103732646 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103732646 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103732646 (Dvl3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 103732646
NCBI-ProteinID: XP_008829491
LinkDB
Position
Un
AA seq 719 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGVHPEPASFCADNPPELPPPLERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSTQRERPRRRDGPEQAARPNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMATIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLTLQDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGSREPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPG
VPPLYGPPMLMMAPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacggccaggagacgccctacttggtgaag
ctgcccctgccggccgaacgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaagaggagatc
tcagatgacaatgccaagctaccctgcttcaatggccgggtggtgtcctggctggtgtca
gctgaaggcgttcacccagaaccagcctccttctgtgctgacaacccaccagagctgcca
cctcctttggagcgcacaggaggcattggggactctcgacccccatccttccaccctcat
gctggtggaggcagccaggagaacctggataatgacacagagactgactccttggtgtct
acccagagagagcggccccgccggagggatggcccagagcaagcagcccggcctaatgga
actgcaaaaggggagcggaggagggagccaggtggctatgacagttcatccacccttatg
agcagtgagctggagactaccagcttctttgactcagatgaggatgactctactagcagg
ttcagcagctccacagaacaaagcagtgcttcacgcctgatgagaagacacaagcgccgg
cggaggaaacagaaagtctctcggatcgaaaggtcctcgtccttcagcagtatcacagac
tccactatgtctctcaacatcatcacagttactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgaggtgacggaggcatctacattggctcc
atcatgaagggtggggctgtggcagctgatggacgcatcgaacccggagatatgttatta
caggtaaatgagatcaactttgagaacatgagtaatgacgatgcagtccgagtactgcgg
gagattgtacataaaccagggcctatcaccctaactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacattacctcggagtgagcccatccggcccattgaccctgcagcc
tgggtctctcacactgcagccatgacgggcactttccctgcctacggcatgagcccctcc
ctgagcaccatcacctctaccagctcctccattaccagctccattcctgatacagagcgc
ctagatgacttccacttgtccatccacagtgacatggccaccatcgtaaaagctatggcc
tctcctgaatcagggttggaggtccgagatcgcatgtggctcaagattactattcccaat
gctttcattggctcagatgtggtggactggctgtaccacaatgtggaaggcttcactgac
cggcgggaggcccgaaagtatgccagcaacctgctgaaagccggcttcatccgccacacc
gtcaacaagatcaccttctctgagcagtgctactacatcttcggtgacctctgtggtaac
atggccaacctgacccttcaggaccacgacggctccagtggcgcatctgaccaggacaca
ctggctcctttgccacaccctggggctgccccctggcctatggctttcccttaccagtac
ccaccgcctccacacccctacaacccacacccaggctttccagaactgggctacagctac
ggagggggcagtgccagcagtcagcacagtgaaggcagtcgcagcagtggctccaaccgt
agtggcagtgaccggcgtaaggagaaggacccaaaggctggggactccaagtcagggggc
agcggcagcgagtcagaccacactacacgcagcagtctgcgggggtcgcgggaacctcgg
gagcgggcgccaagcgagcgttcgggcccagcggccagtgagcacagtcaccgcagccat
cactcgctgaccagcagcctgcgcagccatcacacacacccgagctatggcccacccgga
gtgccccctctctacggccctccaatgctaatgatggccccaccacccgcagccatgggg
cccccaggagcccctccgggccgagacctggcatctgtgcccccggaactcacagccagc
agacagtccttccgcatggcgatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749746
Entry
103749746         CDS       T03372                                 

Gene name
Dvl1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04330  Notch signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103749746 (Dvl1)
   04330 Notch signaling pathway
    103749746 (Dvl1)
   04390 Hippo signaling pathway
    103749746 (Dvl1)
   04150 mTOR signaling pathway
    103749746 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103749746 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103749746 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749746 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103749746 (Dvl1)
   05226 Gastric cancer
    103749746 (Dvl1)
   05217 Basal cell carcinoma
    103749746 (Dvl1)
   05224 Breast cancer
    103749746 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103749746 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    103749746 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103749746 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103749746 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 103749746
NCBI-ProteinID: XP_008850805
LinkDB
Position
Un
AA seq 696 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERVRRRNRDEAARTNGHPRGDRRRDLGLPPDSAST
ALSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPSAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRAPGREKERRAAGAGGS
GSESDHVAPSGSGSTGWRDRPVSQLSRGSSPRSQASAVPPGLPPLHPLTKAYAVVGGPPG
GPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctaccacatggatgaggaggagacaccgtacctggtcaag
ctgccggtggcccccgagcgcgtcacgctggctgacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaaa
gaggagatttttgatgataatgccaagctgccctgcttcaatggccgagtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggtggcattggtgactccaggcccccctccttc
catccaaatgttgccagtagccgagatggaatggacaatgagacaggcacagaatctatg
gtcagtcaccggagggagcgagtccgacgccgaaaccgtgatgaggctgcccgaaccaat
gggcacccaaggggggaccggcggcgggacctggggctgcccccagacagcgcatccact
gcactgagcagtgagctcgagtcaagcagcttcatcgactcagatgaggaggacaacaca
agccggctgagcagctctacagaacagagtacttcttctcggctcattcggaagcacaaa
cgccgccggcggaagcagcgcttgcggcagacagatcgggcctcctccttcagcagcatc
actgactccaccatgtccctgaacattatcaccgtcacactgaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggtggcatctacatc
ggctccatcatgaagggcggggccgtggccgctgacggccgcattgagccaggcgacatg
ctgcttcaggtaaatgatgtcaactttgagaacatgagcaatgatgatgctgtgcgggtg
ctacgggagatcgtatcccagacagggcctatcagcctcacagtggctaagtgctgggat
ccaacccctcggagctactttactatcccaagggctgacccggtgcgacccattgaccca
gctgcctggctgtcgcacacagcagcactgacgggtgccctgccccgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagctggaggaggcaccactgacagtgaagagtgacatgggtgctgttgtccgg
gttatgcagctgccagactcgggactggagatccgtgaccgcatgtggcttaagatcacc
attgctaatgctgtcattggggcggacgtggtggactggctgtacacacatgtggagggc
ttcaaggagcggcgggaggcaaggaaatacgctagcagtatgctgaagcatggcttcctg
cggcacacagttaacaagatcaccttctctgagcagtgctactatgtcttcggcgatctg
tgcagcaacctcgcagccctgaatcttaacagtggctccagtggagcctcggatcaggac
acactagcaccactgcctcacccatctgcaccctggcccttgggtcagggctacccctac
cagtacccggggcccccgccctgcttcccacctgcctaccaggaccctggcttcagctat
ggaagcggcagtgctgggagtcagcagagtgaagggagcaagagcagtgggtccacaagg
agcagccatcgggccccaggccgagagaaggagcgccgtgcggctggagctgggggcagt
ggcagcgaatctgaccacgtagcaccaagcgggtctggtagcactggctggcgggaccgt
cctgttagccagctcagccgaggcagcagccctcgaagtcaggcctcggctgtcccccca
gggcttcccccgctgcaccccctgacaaaggcttatgcagtggtgggtgggccaccagga
gggccacctgtccgggaattggctgctgttcccccagaacttacaggcagccgtcagtcc
ttccaaaaagccatggggaacccctgcgagttcttcgtggatatcatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103752158
Entry
103752158         CDS       T03372                                 

Gene name
Dvl2
Definition
(RefSeq) dishevelled segment polarity protein 2
  KO
K02353  segment polarity protein dishevelled
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04150  mTOR signaling pathway
ngi04310  Wnt signaling pathway
ngi04330  Notch signaling pathway
ngi04390  Hippo signaling pathway
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04916  Melanogenesis
ngi04934  Cushing syndrome
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05217  Basal cell carcinoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103752158 (Dvl2)
   04330 Notch signaling pathway
    103752158 (Dvl2)
   04390 Hippo signaling pathway
    103752158 (Dvl2)
   04150 mTOR signaling pathway
    103752158 (Dvl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103752158 (Dvl2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103752158 (Dvl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103752158 (Dvl2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103752158 (Dvl2)
   05226 Gastric cancer
    103752158 (Dvl2)
   05217 Basal cell carcinoma
    103752158 (Dvl2)
   05224 Breast cancer
    103752158 (Dvl2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103752158 (Dvl2)
   05022 Pathways of neurodegeneration - multiple diseases
    103752158 (Dvl2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103752158 (Dvl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103752158 (Dvl2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 103752158
NCBI-ProteinID: XP_008854073
LinkDB
Position
Un
AA seq 732 aa
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMALPAHEPRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHHENLEPETETESVVSLRRERPRRRDSSEHGGGGHRPSGPSRLE
RHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPR
MERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA
ADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLP
RNEPIQPIDPAAWVSHSAALTGTFPTYPGSSSMSTITSGSSLPDGCEGRGLSIHMDMASV
TKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAG
LIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWP
LLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGR
PEERAPESKSGSGSESELSSRGGSLRRGGEPSGTGDGGPPPSRGSTGGAPNLRALPGLHP
YGPPPGMALPYNPMMVVMMPPPPPPPPVPTAVQPPGAPPVRDLGSVPPELTASRQSFHMA
MGNPSEFFVDVM
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggcgggcagcagtgcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaggaggagactccctacctggtgaagatcccagtccccgcggagcgcatcaccctc
ggcgatttcaaaagcgttctgcagcggcccgccggcgctaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagaaatttcagatgacaacgctcgcctgccttgt
ttcaatggaagggtagtctcctggctagtgtcatcggataatccccaacctgagatggca
ctcccagcccatgagcctcggacagaactggtgcctccacctccaccattacctcctttg
ccgccagaaaggaccagtggcattggggactcgaggcctccatccttccatcatgaaaat
ctggagcctgagacagaaactgagtctgttgtgtcactgagacgggagcgacctcgaagg
agagacagcagtgagcatggcggtggtggccacaggcccagtggcccttcaaggctggag
cgccacctggctgggtacgagagctcctctactctcatgactagtgagctggagagtacc
agcctaggggattcagatgaggatgacaccatgagtcggttcagcagctccacagagcag
agtagtgcctcccgcctcctcaagcgccaccgaaggcgaaggaagcaacgaccacctcgt
atggagaggacctcatccttcagcagcgtcacagattccacaatgtctctcaacatcatc
acagtcacactcaacatggagaagtacaactttctgggcatctccattgtgggccaaagt
aatgaacggggtgacggaggcatctacatcggctccatcatgaaagggggagctgtggct
gctgatggccgcatcgagcctggggacatgcttttgcaggtgaatgacatgaactttgag
aacatgagcaacgatgatgctgtgcgggttctgagagacattgttcacaaaccaggcccc
attgtgctgactgtggccaagtgttgggatccatcaccccaagcctacttcacccttccc
cgaaatgagcccatccagccaattgaccctgctgcctgggtgtcgcattctgctgcgctg
actggcaccttccctacttatccgggttcttcatccatgagcaccattacatctggatcc
tctctccctgatggctgtgaaggtcgaggtctctctatccatatggacatggcctctgtg
accaaagccatggcagccccagagtctgggctggaagtccgggaccgcatgtggctcaag
atcaccatcccaaatgcctttctaggctcagatgtggtcgactggctataccatcacgtg
gagggttttcctgagcgccgggaggcccgcaagtatgccagcgggctgttgaaggcaggc
cttatccgacacactgtgaacaagatcactttttctgagcagtgctattatgtcttcggg
gacctcagtggtggctgtgagagttacctagttaacctgtctttgaatgacaatgatggt
tccagtggggcttcagaccaggataccttggctcctttgcctggggctaccccctggccc
ctgctacccaccttttcctaccaatacccagccccgcacccctacagcccccaaccccca
ccctaccatgagctttcatcttacacctatggtggaggcagtgccagcagccagcacagt
gaggggagccggagcagtgggtcaacaagaagcgatgggggtgctgggcgcacagggagg
cccgaggaacgggctcctgagtcgaagtctggtagtggcagtgagtctgagctctctagc
cggggaggcagccttcggcggggtggggaacctagtgggactggtgatgggggtcctcct
ccatccaggggctcaacagggggtgctcccaatctccgagcccttccaggactccatccc
tatggacctccccctggtatggctctcccctataaccccatgatggtagtcatgatgcct
ccacccccacccccaccccctgtccctacagcagtgcagccccctggtgctcctccagtc
agggacctgggctctgtgcccccagaactgacagctagccgccagagcttccacatggct
atgggtaaccccagtgagttttttgtagatgttatgtaa

DBGET integrated database retrieval system