KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732660
Entry
103732660         CDS       T03372                                 

Gene name
Thpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
ngi04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103732660 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103732660 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103732660 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103732660 (Thpo)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103732660 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103732660
NCBI-ProteinID: XP_008829532
LinkDB
Position
Un
AA seq 414 aa
MNETRLFLSHSGYSPDPLPLAHLCPTPLCAEVQELKPPPWPQERFRGEAPFREPLQPDTL
ARMELTDLLLVVTLLLTTRLTLCSPAPPACDPRLLNKLLRDSHVLHSQLSQCPDISPLST
PVLLPAVDFSLGEWKSQTEQTKAQDVLGAVTLLLEGVMAARGQVEPTCLSSLLGQLSGQV
RLLLGALRGLLGTQGRTTAHKDPNAIFLSFQQLLRGKVRFLLLVEGPTLCVRRALPTTAI
PSSTSLLLTLNKLPNRTSGLLEMNFNVSAKTTGPGLLNRLQEFRAKTVPGQLNQTSRSPD
QIPGYWNRAHGPLNGTHGLFAGASPQTLKVPDIPPGALNTGSLPFNFQPGSPPSPTHPPA
GQYTLSPSLPTSSTLGTPPQLHPLVPDPATKVHNSTSPRPITVYSHSQNLSQEA
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaatgaaactcgactatttctgtcacattcaggatacagtccagaccctcttcccttg
gcccacctgtgccctaccccactctgtgcagaagtgcaagagctcaagccgcctccatgg
ccccaggaaagattcaggggagaggccccattcagggagccactccagccagacaccctg
gccagaatggagctgactgatttgctcctcgtggtcacacttctccttactacaagacta
actctgtgcagcccggctcctcctgcctgtgaccctcgacttctaaataaactgctccgt
gactcccatgtccttcacagccaactgagccagtgcccagacatcagtcctttgtccaca
cctgtcctgttgcctgctgtggactttagcctgggagaatggaaatctcagacggagcag
accaaggcacaggacgttctaggggcagtgaccctactactggagggagtaatggcagcc
cgaggacaggtagaacccacctgcctttcatctctcctgggacagctttctgggcaggtc
cgcctcctcctgggggccttgcggggccttcttggaacccagggcaggaccacagctcac
aaggatcccaatgccatcttcctgagcttccaacaactgctccgaggaaaggtgcgtttc
ctgctgcttgtagaaggtcccaccctctgtgtcaggcgggccctgcccaccacagctatc
ccaagcagtacctccttactcctcacactgaacaagctcccaaacaggacttctggattg
ttggagatgaacttcaatgtctcagccaaaactactggccctggacttctgaacaggctg
caagaattcagagccaagactgttcctggtcaactgaatcaaacttccaggtcccccgac
caaatccccggatactggaacagggcacatggacccttgaatggaactcatggactcttt
gctggagcctcaccccagaccctcaaagtcccagacattccaccaggagctttgaacaca
ggctccctgccattcaacttccagcctggatctcctccttccccaacccatcctcctgct
ggacagtacacactctccccttctttacccacctcgtccacccttgggactccaccccag
ctccaccctctggttcctgatcctgccaccaaagtgcataactctaccagccctcgtcca
atcacagtgtactctcattcccagaatttgtctcaggaagcataa

DBGET integrated database retrieval system