KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732728Help
Entry
103732728         CDS       T03372                                 

Gene name
Caskin2
Definition
(RefSeq) CASK interacting protein 2
  KO
K21952  CASK-interacting protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103732728 (Caskin2)
Membrane trafficking [BR:ngi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103732728 (Caskin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 SAM_1 Ank_4 Ank Caskin-Pro-rich Ank_3 Caskin-tail SAM_2 SH3_2 Caskin1-CID SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 103732728
NCBI-ProteinID: XP_008829631
LinkDB All DBs
Position
Un
AA seq 1200 aa AA seqDB search
MGREQDLILAVKNGDVTCVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNIRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGIPVARLPSAP
TPLRPGFSRTPQSSADDPLHPLTYGQLPRMGLNPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTSLLIENAQPLPSATEDQVLPGLHAPSLADNPNHRPLASYRSGESFTQDVR
PEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKK
IASEIAQLSIAEWLPNYIPMDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI
GVNKLGHQKKLMLGVKRLAELRRGLLQGEALGEGGRRLARGPELMAIEGLENGEGPAMAG
PRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPVSQPSV
GDPSAPQERNLPEGTERPPKLCSPLPSQGPTPYVFMCPQSSPSPAPGPPPGAPRAFSYLA
GSPVTPPDPPRPKRRSHSLSRPGPTEGEAEGEAEGPLGSALGSYATLTRRPGRSTLARTS
PSLTPARGTPRSQSFALRARRKGPPPPPPKRLSSVSGSTEPSSLDGSLGPKDGAAGPRRR
TLSEPTGPSEPPAPPAPAGPVSDTEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIKQRPKP
AGPPPRETPVPPGLDFNLTESDTVKRRPKCREREPLQTALLAFGVVGDTPSLVETPLSSQ
APCESPSSVSSSPPQPEPSSLATQGAPAPSLSPIIQPPGHLGPCTGPAVENSTGSRLNVE
TEPPAALAALLKVPGTGTALKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGPVGPG
RAQQRLEQTSSSLAAALRAAEKSIGTEEREGPPGTSTKHILDDISTMFDALADQLDAMLD
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atggggcgtgaacaggacctgatccttgctgtcaagaatggagatgtgacctgcgtgcag
aaactggtggccaaggttaaggctgcaaaaacaaagctcctaggctccacgaagaggctc
aatgtcaactaccaggatgctgatggattctcagctctccaccatgctgccttggggggc
agcctggagctcatagccttgctactggaggctcaagccactgttgacatcaaagacagc
aatggcatgcgtccattgcactatgcagcctggcagggccggctggagcctgtgagactg
ttgcttcgggcctctgcagctgtcaatgctgcttccctggatgggcagatccctttgcac
ctggctgcacagtatgggcactatgaggtgtcagaaatgctcctccagcaccaatccaac
ccttgcctggtcaacaaagcgaagaagacgcccctagacctggcctgtgaatttgggcgg
ctcaaggtggcccagttgctactgaacagccacttatgtgtggcactgctggagggagag
gcaaaggacccatgtgaccccaactacaccacgcccttacacttggctgccaagaatggc
catagagaagtcatcaggcagctcttgagagctggtattgagatcaaccgccagaccaag
acaggaactgcactccacgaggctgcactatatggcaagaccgaggtggtacggctgctc
ctagagggaggtgtggacgtgaacatccggaacacatacaaccagacggcactggatata
gtgaatcagttcaccacctcccaggccagccgggaaattaagcagctacttcgtgaggct
tcagggatcctgaaggtccgagcactcaaggatttctggaacctccatgaccccactgct
ctcaatatccgggcaggagatgtcatcacggtgcttgagcagcaccctgatggtcgctgg
aaaggccacatccatgagagccaaaggggcacagaccgtgtgggctactttcccccaggc
atcgttgaggtggtcagcaagcgggtgggcattcccgtggcccgtctcccctctgcaccc
acacccctgcgaccaggcttctctcggacaccacaatcctctgctgatgatcccctgcac
ccgcttacctatggccagctccctcgcatgggccttaacccagacagtccagcaggtgac
aggaatagcgtggggagcgagggcagtgtgggcagcatccgcagtgctggtagtgggcag
agttccgaaggcaccaatggccatggcaccagcctccttattgaaaatgcccagccactg
ccctctgccactgaggaccaggtgctgccaggactgcatgccccatccctggcagacaac
ccgaatcaccgccctctggccagctaccgctctggggagagcttcacccaggatgtaagg
ccggagcagttgctggaaggaaaggatgcacaggccattcataactggctaagtgaattc
cagctggaaggctacactgcccacttcctgcaggctggctatgatgtgccaaccatcagt
cgcatgacacctgaggatctgacggccatcggggtgaccaagcctggacacaggaagaag
atcgcctcggagattgcccagctcagcattgctgagtggctgcccaactatatcccgatg
gacttgctggagtggctatgtgcgctggggctgccacagtaccacaagcagctggtgagc
agtggctatgactccatggggctggtggctgatctcacctgggaggagctgcaggagata
ggcgtcaacaagctgggccatcagaagaagcttatgctgggtgtgaagaggctagcagag
cttcgtcggggcctgctacagggagaggccctaggtgaaggcgggcgtcggctggccagg
ggtccagagctgatggccattgaagggctggagaatggggaaggtccggccatggctggg
cctcgcctcctcacctttcaaggcagtgagctgagcccggaactgcaggcagctatggca
gggggtggcccagaaccactacctcttccccctgcacgttctcctagccaggagagcatt
ggagcacgttcacgggggtctggtcactcacaggaacagcctgtctcccaaccaagtgtt
ggagaccccagtgccccacaggagaggaaccttccagagggtacagagcgcccccctaag
ctttgttccccacttcctagccaaggacctaccccctatgtttttatgtgcccacagagt
tcacctagcccagccccagggccacctcctggtgcaccccgggccttctcctacttggct
gggtctcctgtcactcctccagacccacctcggcccaagcgccggtctcacagcctgagc
cgccctggccctactgagggggaagctgaaggggaggccgaagggccactgggcagtgcc
ttgggcagttatgccactctcacccggagaccaggacgcagcacccttgcccggaccagt
cctagcctgactccagctcgagggaccccccgcagccagtcatttgccctccgcgcccgt
cgtaaaggccctccacccccaccacccaagcgtctcagttcagtctctggctccacagag
ccatcttcactagatggaagcctggggcccaaagatggggctgcagggccccgaaggaga
acactgagtgaaccgactggcccctcagagccccctgcccctcctgccccagctggccct
gtgtcggacacagaagaggagcctggtcctgaggggacaccgccatctcggggcagctca
ggagaagggctgccattcgcagaggaagggaatctgactatcaagcagcggcctaagcca
gctggccccccaccccgggagactcctgttccccctggccttgacttcaaccttacagag
tcagatactgtcaaacggagacccaaatgcagagagagagagccattacagaccgcactg
ttggcctttggtgtggtgggtgacacccctagcctagtggaaactcccctgtcctcccag
gccccctgtgaatctccctcctcagtttcctccagccctccacagcctgaacctagcagc
cttgcaactcaaggagctccagccccttctctcagtcccataatacagccccctggccac
ctagggccatgcactgggccagctgtggaaaattcaacaggcagtcggctgaatgtggag
acagagcctccagctgcccttgctgccctccttaaagtgcctggcacaggaacagccctc
aagcctgtttctgtggcctgcactcagctggcattttctggcccaaagctggctccccgg
ctcggcccccgcccagtaccccctccaaggcctgagagcactgggcctgtgggtccaggc
cgggcccaacagagactggaacaaaccagttcatccctggcagctgcactgagggcagct
gagaagagcattggcactgaggagcgagagggccctccagggacctctaccaagcacatt
ctggatgacatcagtaccatgtttgatgctttggctgaccagctggatgccatgctggac
tga

DBGET integrated database retrieval system