KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732897
Entry
103732897         CDS       T03372                                 

Gene name
Mtor
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04012  ErbB signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04136  Autophagy - other
ngi04140  Autophagy - animal
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04218  Cellular senescence
ngi04371  Apelin signaling pathway
ngi04613  Neutrophil extracellular trap formation
ngi04630  JAK-STAT signaling pathway
ngi04659  Th17 cell differentiation
ngi04714  Thermogenesis
ngi04910  Insulin signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04935  Growth hormone synthesis, secretion and action
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103732897 (Mtor)
   04371 Apelin signaling pathway
    103732897 (Mtor)
   04630 JAK-STAT signaling pathway
    103732897 (Mtor)
   04066 HIF-1 signaling pathway
    103732897 (Mtor)
   04072 Phospholipase D signaling pathway
    103732897 (Mtor)
   04151 PI3K-Akt signaling pathway
    103732897 (Mtor)
   04152 AMPK signaling pathway
    103732897 (Mtor)
   04150 mTOR signaling pathway
    103732897 (Mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103732897 (Mtor)
   04136 Autophagy - other
    103732897 (Mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    103732897 (Mtor)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    103732897 (Mtor)
   04659 Th17 cell differentiation
    103732897 (Mtor)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103732897 (Mtor)
   04920 Adipocytokine signaling pathway
    103732897 (Mtor)
   04935 Growth hormone synthesis, secretion and action
    103732897 (Mtor)
   04919 Thyroid hormone signaling pathway
    103732897 (Mtor)
  09149 Aging
   04211 Longevity regulating pathway
    103732897 (Mtor)
   04213 Longevity regulating pathway - multiple species
    103732897 (Mtor)
  09159 Environmental adaptation
   04714 Thermogenesis
    103732897 (Mtor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103732897 (Mtor)
   05206 MicroRNAs in cancer
    103732897 (Mtor)
   05205 Proteoglycans in cancer
    103732897 (Mtor)
   05230 Central carbon metabolism in cancer
    103732897 (Mtor)
   05231 Choline metabolism in cancer
    103732897 (Mtor)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103732897 (Mtor)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103732897 (Mtor)
   05212 Pancreatic cancer
    103732897 (Mtor)
   05225 Hepatocellular carcinoma
    103732897 (Mtor)
   05226 Gastric cancer
    103732897 (Mtor)
   05214 Glioma
    103732897 (Mtor)
   05221 Acute myeloid leukemia
    103732897 (Mtor)
   05215 Prostate cancer
    103732897 (Mtor)
   05224 Breast cancer
    103732897 (Mtor)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103732897 (Mtor)
   05014 Amyotrophic lateral sclerosis
    103732897 (Mtor)
   05016 Huntington disease
    103732897 (Mtor)
   05017 Spinocerebellar ataxia
    103732897 (Mtor)
   05022 Pathways of neurodegeneration - multiple diseases
    103732897 (Mtor)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103732897 (Mtor)
   04931 Insulin resistance
    103732897 (Mtor)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103732897 (Mtor)
   05168 Herpes simplex virus 1 infection
    103732897 (Mtor)
   05163 Human cytomegalovirus infection
    103732897 (Mtor)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103732897 (Mtor)
   05165 Human papillomavirus infection
    103732897 (Mtor)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103732897 (Mtor)
   01522 Endocrine resistance
    103732897 (Mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103732897 (Mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103732897 (Mtor)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103732897 (Mtor)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103732897 (Mtor)
Membrane trafficking [BR:ngi04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    103732897 (Mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 103732897
NCBI-ProteinID: XP_008829852
LinkDB
Position
Un
AA seq 2549 aa
MLGTGPAAAAATATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
RDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDAMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLNTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAVQLFGANLDDYLHLLLPPIVKLFDAPEAPLPLRRAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMQRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMLPQAQHDIASEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVWQYYSAATEHDHSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHSSGANITSTTTTATTAAAAAAATSTEGSNSESETESTENSP
SPSPRQKRVTEDLSKTLLMYTIPAVEGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaactggccctgccgcggctgctgccaccgccaccacgtctagcaatgtgagt
gttctgcagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggagcttcgtgagatgagtcaggaggagtct
acacgtttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcctggctatcgcgagtctcataggagtggaaggtgggaat
tccacccgaattggccgatttgccaactaccttcggaacctccttccctccagtgaccca
gttgtcatggaaatggcatccaaggccattggccgccttgctatggcaggggatactttc
accgctgagtatgtggagtttgaagtgaagcgagctttggaatggctgggtgctgaccgc
aatgagggccggagacatgcggctgttctggttctccgtgagctggccatcagtgttccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaagcaggccatccgtgagggagctgtagctgcccttcgcgcctgtctgattcttacc
acccagcgggagccaaaggagatgcagaagccacagtggtacaggcacacatttgaagaa
gcagagaaagggtttgatgagacgctggccaaggagaagggcatgaaccgggatgatcga
attcatggggccttactgatcctcaacgagctggtccgcatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacccagcagcagctggtccacgacaagtactgc
agagacctcatgggctttgggacaaagccgcgccacattacccccttcaccagtttccag
gccgtccagccccagcagtcaaatgccttggtaggactgctggggtatagctctcaccaa
ggcctcatgggattcggagcttcccccagccctgctaagtccactctggtggagagccgg
tgttgtagagacttgatggaggagaagtttgatcaggtgtgccagtgggtgctgaaatgc
aggagcagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcgttccgaccttctgccttcacagatacccagtacctccaagatgccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacggacagcagcattccaggccctggggctgctt
tctgtggctgtgaggtccgagtttaaggtctacttacctcgtgtgctggacatcatccga
gcagccctgcccccaaaggactttgcccacaagaggcagaaaacgatgcaggtggatgcc
acagtgttcacatgcatcagtatgctggcccgagccatgggcccgggtatccagcaggac
atcaaggagctgttggagcctatgctggcagtgggtctgagccctgcgctcactgccgtg
ctctacgacctgagccgacagattccacagctgaagaaggacatccaggatgggctcctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctagcctcccctggcctcaacactctccctgaggccagtgatgtggcc
agtattacccttgccctccgaacccttggcagctttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctgaacagtgagcataaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacgccctccatccacctcatcagcggccat
gcccatgtggttagccagactgctgtgcaagtagtagcagatgtgctcagcaaactactt
gtggttgggataacagatcctgaccccgatatccgctactgtgtcttggcatctctggac
gaacgctttgatgcccacctggcccaggcagagaatttgcaagctctctttgtggccctg
aacgaccaggtctttgagatccgagaactggccatctgcactgtgggccgactcagtagc
atgaacccggccttcgtaatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattgggagaatcaaggagcagagtgcccgcatgctggggcacctc
gtctccaatgccccccgactcatccgcccctatatggagcctattctgaaggctttaatt
ttgaaactgaaggatccagatcctgatccaaacccaggtgtgatcaataatgttctggcc
acaataggagaattggctcaggttagtggcctggagatgaggaagtgggtagatgagctt
tttatcatcatcatggacatgctccaggactcctctctcttggccaaaaggcaggtggca
ctgtggaccctggggcagttggtggccagcactggctatgtagtggagccctacaggaag
taccctaccctgcttgaagtgctactgaattttctgaagactgaacagaaccagggcacg
aggagagaggctatccgtgtgttagggctccttggggctctggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgggatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaagattcctctgactacagcaccagtgaaatgctagtcaacatgggaaac
ctgcccttggacgagttctacccagctgtgtccatggtagccctgatgcggatcttccga
gatcagtccctctctcaccatcacaccatggtggtccaggccatcaccttcatcttcaaa
tccctggggctcaagtgtgtacagttcctgccccaggtcatgcccacattccttaatgtc
atccgggtctgtgatggagctatccgggaatttctgttccagcagctgggaatgctggta
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaatcgta
gtagcccttggaggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagccaaggccgcattgtctccatcaagctcttagccgcagtc
cagctgtttggtgccaacctagatgactatctgcatctgttgttgcctcccatcgtgaag
ctgtttgatgcccctgaagccccactgccattgcgaagggcagcgttggagacggtggac
cgtctgacagagtccctcgatttcactgactatgcctcccggatcattcaccccattgtt
cgaacactggaccagagcccagagcttcgttccacagccatggacacgctgtcttcactt
gtctttcaactcgggaagaagtaccagattttcataccaatggtgaataaagtactggtg
cgacaccgaatcaaccaccagcgctatgatgtgcttatttgcagaatcgtcaagggatac
acccttgctgatgaggaagaggaccctttgatctaccagcatcgaatgcaaaggagtggc
caaggagatgcgttggccagtggaccagttgagacaggacccatgaagaaactgcatgtc
agcaccatcaaccttcaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctggaatggctgagacggttgagcttggagctgctgaaggactcctcgtcaccttccctg
cgctcatgctgggccctggcacaggcctacaaccctatggccagggatctcttcaacgct
gcatttgtgtcctgctggtctgagctaaatgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaagacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgcctctgagagatgacaatggcatt
gttctgcttggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gagctggagttccagaaaggtcccacacctgccatactcgagtccctcatcagcattaac
aataagctacagcagccagaagcagctgccggggtgttagaatatgccatgaaacacttt
ggagagctggagatccaggccacctggtatgagaaactgcatgagtgggaggacgctctt
gtggcctatgacaagaagatggacaccaataaggatgacccagagctgatgctgggccgc
atgcgctgtctggaggccttgggggaatggggacagcttcaccaacagtgctgtgaaaag
tggactctggttaatgatgagacccaagctaagatggcccggatggctgctgcagcagcg
tggggcttaggtcagtgggacagcatggaggagtacacctgtatgattccccgggacacc
catgatggagctttttacagagccgtgctggcgctgcatcaggacctcttctccttggcc
caacagtgcattgacaaggccagagacctgctagatgctgagctaactgccatggcagga
gagagctacagtcgggcctatggggccatggtttcttgccacatgctgtctgagctggag
gaggttatccagtacaaacttgtccctgagcgacgagagatcatccgccagatctggtgg
gagagattgcagggctgccagcgtattgtggaagactggcaaaaaatcctcatggtgcgg
tcccttgtggtgagccctcatgaggacatgagaacctggctgaagtacgcaagtctctgt
ggcaagagcggcagactggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccgtctcggcagcttgaccatcctctgccaacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaaaagtgctcgaaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgctgccacaggctcagcatgacatcgcctctgaggaccagcagcacaag
caggagctgcacaaactcatggccaggtgtttcctgaagcttggggagtggcagctgaac
ctccagggcatcaacgagagcaccatccccaaagtgtggcagtactacagcgcagccaca
gagcacgaccacagctggtacaaggcctggcatgcatgggcagtgatgaactttgaagct
gtgctacactacaaacatcagaaccaagcccgagatgagaagaagaaactgcgtcactcc
agcggggcaaacatcaccagtaccaccacgacagccaccacagctgccgctgctgctgct
gccaccagcacagagggcagcaacagcgagagtgagactgagagcacagagaacagcccc
agcccatcccctcggcaaaagagggtcactgaggatttgtccaaaactctcttaatgtac
actatccctgctgtggagggcttcttccgttctatctccttgtcaagaggcaacaacctc
caggatacactcagagtcctcaccctgtggtttgattatggtcattggccagatgtcaat
gaagccttagttgaaggggtgaaggccatccagattgatacttggttacaggttatacct
cagctcattgcaagaattgatacccctagacccttggtgggccgacttattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgacagtggcttcc
aagtctactacgacagcccgtcacaacgcagccaacaagatcctgaagaacatgtgtgag
cacagcaacactttggtccagcaagccatgatggtgagtgaagaactgatccgagtggcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtacttcggg
gagagaaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgg
ggcccccagactctgaaggaaacatcctttaaccaggcatatggtcgagatttaatggag
gctcaagagtggtgtaggaagtacatgaaatcagggaacgtcaaggacctcacgcaagcc
tgggacctctattaccatgttttcaggcggatctccaagcaactgccccagctcacatcc
ctagaactgcagtatgtttccccaaagcttctgatgtgccgggaccttgagttggccgta
ccaggaacctatgaccccaatcagcccatcatccgcattcagtccatagccccatctttg
caagtcatcacatccaagcagaggccccggaagttgactctgatgggcagcaatgggcac
gagtttgtttttctcctgaaaggccatgaagatctccggcaggatgagcgagtgatgcag
ctctttggcctagtgaacacactcctggccaatgacccaacatctcttcggaaaaacctc
agcatccagaggtatgcagtcatccctttgtccaccaactcaggcctcattggctgggtc
ccccactgtgacacgctgcatgcgctcatacgggactacagggagaagaagaagatcctg
ctcaacattgagcaccgcatcatgctgcggatggctccagactatgaccatctgaccctg
atgcagaaggtggaggtgtttgagcatgccgtcaacaacacagctggggatgatctggct
aagctactgtggctgaaaagccccagctcagaggtgtggtttgaccgaaggaccaattat
acccgctctttagctgtcatgtcaatggttggatacattttaggcctgggggacagacac
ccatccaacctgatgctggaccgactgagcggaaagatcctgcacattgactttggggac
tgctttgaggttgctatgaccagagagaaatttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggtctggatggcaactacagaatcacatgc
cacacagtgatggaagtgcttcgggaacacaaggacagtgtcatggctgtgctggaggcc
tttgtctatgaccctttgctgaactggagactgatggacacaaataccaaaggcaataag
agatccagaacgaggacggattcctactctgcaggccagtcagtagaaattttggatggt
gtggaacttggagaaccggctcataagaaagcaggaaccacagtaccagaatccattcac
tctttcattggagatggtttggtgaaaccagaagccctaaataagaaagctattcagatt
attaacagggttcgagataagctcactggccgagatttctctcatgatgacaccttggat
gttcccacacaagtggagctgctcatcaaacaagcaacatcccacgaaaacctctgccag
tgctacattggctggtgtcccttctggtaa

DBGET integrated database retrieval system