KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103732915Help
Entry
103732915         CDS       T03372                                 

Gene name
F13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103732915 (F13a1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103732915 (F13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103732915
NCBI-ProteinID: XP_008829876
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MSDTPGTTFGGRRAVPPNNSNAAEDDLPTQELQGLVPRGVNLQDYLNVVSVHLFKQRWDS
NKIDHHTDKYDNNKLIVRRGQPFYIQIDFDRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PVVSELQSGKWGAKVIMNEDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTRRDPETD
TYILFNPWCEEDAVYLDDEKEREEYILNDIGVIFYGDVKDIKSRSWSYGQFEDGILDACL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGIPPSAWTGSVDIL
LEYRSSEKPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVESVDTTHIGKLIVTKQIGGDGMEDITD
TYKFQEGQEEERLALETALMYGAKKAVNTEGVVKSRSDVDMNFEVENAVLGKDFKVTITF
QNNSSNRYTISAYLSGNITFYTGVSKTEFKNEAFEVTLEPLSFKKNEVLVRAGEYMSQLL
EQAFLHFFVTARVNESRDVLAKQKSIVLTIPKVIIKVRGTAMVGSDMIVTVEFTNPLKET
LQNVWIHLDGPGVTRPKRKMFNEIRPNATVQWEEVCRPWVSGPRKLIASMSSDSLRHVYG
ELDLQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatactcctgggaccacctttggcggcaggagagctgttccacccaacaactcc
aatgcagcggaagacgacctcccgacccaggaactgcagggcctggtgccccggggtgtc
aacctgcaagattacctgaatgttgtatctgttcacctgttcaagcagagatgggacagc
aacaagatcgatcaccacacagacaagtatgataacaacaagttgattgtccgcaggggg
cagcctttctacatccagattgacttcgatcgtccatatgatcccaggagggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaacaagggcacctatatcccagtg
ccggtagtgtcagagctgcaaagtggaaagtggggggctaaggttataatgaatgaagac
aggtctgtccgactgtccatccagtcttcccctgagtgcattgtagggaaattccgcatg
tatgttgctgtctggaccccctatgggatcctccgcacccgcagagacccagaaacagac
acatatattctcttcaatccttggtgtgaagaggatgctgtatatctggatgatgagaaa
gagagagaagaatacatccttaatgacatcggagtgatattttatggagacgtcaaagac
atcaagagccgaagctggagctatggccagtttgaagatggcatccttgatgcttgcttg
tatgtgatggacagagcacaaatggacctttcaggcagagggaaccccatcaaagtcagc
cgtgttggatctgcaatggtgaatgccaaagatgacgaaggtgtccttgttggctcatgg
gataatatctacgcttatggcatccctccatcagcctggaccggaagtgttgacattcta
ctagaatataggagctctgagaagccagtccgatatggccagtgctgggtttttgctggt
gtcttcaacacctttttgcgatgccttggaattccagcaagaatagttactaattatttc
tcagcccatgacaatgatgccaatttgcaaatggacatctttctggaagaagatgggaac
gtgagctctaaactcaccaaggactcagtgtggaactaccactgctggaacgaagcttgg
atgacaaggcctgatcttcctgttgggttcggaggctggcaggctgtggacagcacaccc
caggaaaacagtgatggtatgtaccgctgtggccccgcctctgttcaagctgttaagcat
ggccacgtctgcttccagtttgatgccccctttgtttttgcagaggtcaacagcgatctt
atttacattacagctaagaaagatggcactcatgtagtagaatctgtggataccacccac
attggaaaactgattgtgaccaagcaaattggaggagatggcatggaggatatcactgat
acttacaagttccaagaaggtcaagaggaagaaagactggccctcgaaacagctctgatg
tacggagccaaaaaggctgtcaacacagaaggtgttgtcaaatccaggtctgacgtagac
atgaactttgaagtggaaaatgctgtgctgggaaaagacttcaaggtcaccatcactttc
cagaacaacagctccaatcgttacaccatctcagcctatctttcaggcaacatcaccttc
tacactggggtctccaagacagaattcaagaatgaggcatttgaagtaacgctggagccc
ttgtccttcaagaaaaacgaggtgctggtcagagcgggcgagtacatgagccagctgcta
gaacaggcgttcctgcacttcttcgtcacagcacgtgtcaatgagtccagagatgtccta
gccaagcaaaagtcaatagtgctgaccatccccaaggtcatcatcaaggtccgaggcact
gccatggttggctctgatatgattgtgactgttgagttcaccaatcctttaaaagaaaca
ctgcaaaatgtctggatccatctggatggtcctggagtgacaagacccaagaggaagatg
ttcaatgaaatccggccgaatgccaccgtacagtgggaagaagtatgtcggccttgggtc
tctggccctcggaagctgattgccagcatgagcagtgactccctgagacacgtttatggc
gagctggatctgcagattcaaaggcgaccttccatgtaa

DBGET integrated database retrieval system