KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733205
Entry
103733205         CDS       T03372                                 

Gene name
Frat1
Definition
(RefSeq) FRAT1, WNT signaling pathway regulator
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05200  Pathways in cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103733205 (Frat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733205 (Frat1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103733205 (Frat1)
   05226 Gastric cancer
    103733205 (Frat1)
   05224 Breast cancer
    103733205 (Frat1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103733205 (Frat1)
   05022 Pathways of neurodegeneration - multiple diseases
    103733205 (Frat1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 103733205
NCBI-ProteinID: XP_008830208
LinkDB
Position
Un
AA seq 272 aa
MPCRREEEEEEEEEEAGEEAEGEEDDDSFLLLEQSVTLGGSADVDRLIAQIGETLQLDAA
QHSPASPRAAPGQPPPPRQALAADKXRDXXXXXXXXXXXXXXVRCALGDRGRLRGRAAPY
CVAELAAGPGALSPMLPQPGVNRPPGAGKQSILQPLSGPCRRGWLRSAAASRRLQQRRGS
QPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLHAKVPPHEFLGPLSAPVHEPP
SPRSPRAACSDPGASARRARLRAGDDLLVPGS
NT seq 819 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaggaggaggaggaggaggaggaagccggtgaggaagcg
gagggggaggaggacgacgacagcttcctcctgctggagcagtcggtaacactgggcggc
tcggccgacgtggaccggctcatcgcccagatcggcgagactctgcagctggacgcggcg
cagcacagcccggcctccccgcgtgcggctccggggcagccgccgccgccccggcaggcg
ctggcggctgacaagncccgggaccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnncgtgcgctgcgccctgggggaccgcggccgcctgcggggccgggcggcgccctac
tgcgtggcggagctggccgcgggccccggcgcgctgtcccccatgctcccgcagcccggc
gtgaatagaccccctggagcgggcaagcaaagcatcctgcagccgctgtctggcccgtgc
cggcgagggtggctccggagcgcggccgcgtcccgccgcttgcaacagcgacgcgggtct
cagcctgaaacccgcaccggcgacgacgacccgcaccggctcctgcagcagctcgtgctg
tcgggaaaccttatcaaggaggcagtgcgaaggctacattcgcgaaggctgcagttacac
gcaaaggtccctcctcacgagttcctcgggcctctgtcggccccggtgcatgagccccct
tcgccccgaagccctcgcgcagcctgcagcgaccccggtgcctccgcgaggagggcgcgg
ctcagagctggggacgaccttctggtccccggtagctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733235
Entry
103733235         CDS       T03372                                 

Gene name
Frat2
Definition
(RefSeq) FRAT2, WNT signaling pathway regulator
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04310  Wnt signaling pathway
ngi05010  Alzheimer disease
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05200  Pathways in cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103733235 (Frat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733235 (Frat2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103733235 (Frat2)
   05226 Gastric cancer
    103733235 (Frat2)
   05224 Breast cancer
    103733235 (Frat2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103733235 (Frat2)
   05022 Pathways of neurodegeneration - multiple diseases
    103733235 (Frat2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 103733235
NCBI-ProteinID: XP_008830265
LinkDB
Position
Un
AA seq 195 aa
MPCRREEEEEEAGEEAEGEEDDDSFLLLEQSVTLGGSADVDRLIAQIGETLQLDAAQHSP
AAPRAAPGPPPPPGAVRCALGDRGRVRGRAAPYCVAELAAGPDALPGSCRRGWLRGAVAS
RRLHQRRWTPAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATSPAGAGGGR
SAPDSVALQPSGAWL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaggaggaggaagccggtgaggaagcggagggggaggag
gacgacgacagcttcctcctgctggagcagtcggtgacgctgggcggctcggccgacgtg
gaccgactcatcgcccagatcggcgagactctgcaactggacgcggcgcagcacagcccg
gccgccccgcgtgcggccccggggccgccgccacccccgggggccgtccgctgcgcccta
ggggaccgcggccgcgtgcggggccgggcggcgccctactgcgtggctgagctggctgcg
ggccccgacgcgttgccggggtcgtgccgccgaggctggcttcggggcgccgttgcgtct
cggcgtctacatcagcgacggtggaccccggccggggcaagggccggcgacgacgacccg
caccggctccttcagcagctggtgctgtcgggaaacctcatcaaggaagcggtgcggagg
ctccagcgagccgtcgcggcggtcgcagccacgagccccgcgggggctgggggaggccga
agcgcaccagactcggtggccctgcagccctcgggcgcctggctatga

DBGET integrated database retrieval system