KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733344
Entry
103733344         CDS       T03372                                 

Gene name
Cntf
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103733344 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103733344 (Cntf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103733344 (Cntf)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  CSF and other factors
   103733344 (Cntf)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 103733344
NCBI-ProteinID: XP_008830388
LinkDB
Position
Un
AA seq 200 aa
MAFAEHSPLTLHRRDLCSRSIWLARKIRLDLTALMESYVKHQGLNKNINLDSVDGVPMAS
TDRWSEMTEAERLKENLRAYRVFHVMLARLLEDQRVHFTPTEGDFHQAIHTLLLQVSAFA
YQLEELMMLLEHKIPPNEAVGSPATIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQMGVPAHESSSMSKDKKI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcttttgcagagcactcaccactgacccttcaccgccgggacctctgtagccgctct
atctggctagcaaggaagattcgtttagacctgactgctcttatggaatcttatgtaaag
catcagggcctgaacaagaatatcaacctagactctgtagatggtgtgccaatggcaagc
actgatcgctggagtgagatgacggaggcagagcgactcaaagagaacctccgggcttac
cgtgtcttccatgtcatgttggcaaggcttttagaagaccagagagtgcatttcacccca
actgaaggtgacttccatcaggccatacacacccttctgctccaagtttctgcctttgcc
tatcagctagaggagctaatgatgcttctggaacacaagatccccccaaatgaggctgtt
gggtctcctgccactattggagatggtggcctctttgagaagaagctgtggggcttgaag
gtgcttcaggagctttcgcagtggaccgtgcggtccatccatgaccttcgtgtcatttct
tctcatcagatgggagtcccagcacatgagagcagttctatgtctaaggacaagaaaata
tag

DBGET integrated database retrieval system