KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733571
Entry
103733571         CDS       T03372                                 

Gene name
Cdkn2c
Definition
(RefSeq) cyclin dependent kinase inhibitor 2C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01522  Endocrine resistance
ngi04110  Cell cycle
ngi04934  Cushing syndrome
ngi05166  Human T-cell leukemia virus 1 infection
ngi05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103733571 (Cdkn2c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103733571 (Cdkn2c)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103733571 (Cdkn2c)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103733571 (Cdkn2c)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103733571 (Cdkn2c)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 103733571
NCBI-ProteinID: XP_008830655
LinkDB
Position
Un
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQTNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPNLKDRTGFAVIHDAARAGFLDTVQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLVKHTASNVGHRNHKGDTAFDLARLYGRNKVISLMEENGVGGATNLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttacgagtttgttgcaaactaatgtaaacgtcaacgcacaaaatggatttgggagaact
gcactgcaggttatgaaacttggaaatcctgagattgccaggagactgctactcagaggt
gctaatcccaatttgaaagaccgaactggtttcgctgtcattcatgatgcagccagagca
ggtttcctggacactgtacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctcccggtggtggag
ttccttgtgaagcacacagccagcaatgtggggcatcggaatcataagggagacactgcc
tttgacttggccaggctctatggaaggaacaaggtcattagcctgatggaagaaaatgga
gtggggggagccacaaatctgcagtga

DBGET integrated database retrieval system