KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733723
Entry
103733723         CDS       T03372                                 

Gene name
Igf1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04114  Oocyte meiosis
ngi04115  p53 signaling pathway
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04510  Focal adhesion
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi04935  Growth hormone synthesis, secretion and action
ngi04960  Aldosterone-regulated sodium reabsorption
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05410  Hypertrophic cardiomyopathy
ngi05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103733723 (Igf1)
   04014 Ras signaling pathway
    103733723 (Igf1)
   04015 Rap1 signaling pathway
    103733723 (Igf1)
   04066 HIF-1 signaling pathway
    103733723 (Igf1)
   04068 FoxO signaling pathway
    103733723 (Igf1)
   04151 PI3K-Akt signaling pathway
    103733723 (Igf1)
   04152 AMPK signaling pathway
    103733723 (Igf1)
   04150 mTOR signaling pathway
    103733723 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103733723 (Igf1)
   04115 p53 signaling pathway
    103733723 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103733723 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103733723 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103733723 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    103733723 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    103733723 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103733723 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    103733723 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103733723 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    103733723 (Igf1)
   04213 Longevity regulating pathway - multiple species
    103733723 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733723 (Igf1)
   05202 Transcriptional misregulation in cancer
    103733723 (Igf1)
   05205 Proteoglycans in cancer
    103733723 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    103733723 (Igf1)
   05218 Melanoma
    103733723 (Igf1)
   05215 Prostate cancer
    103733723 (Igf1)
   05224 Breast cancer
    103733723 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103733723 (Igf1)
   05414 Dilated cardiomyopathy
    103733723 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103733723 (Igf1)
   01522 Endocrine resistance
    103733723 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103733723 (Igf1)
Cytokines and growth factors [BR:ngi04052]
 Growth factors
  Growth factors (RTK binding)
   103733723 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 103733723
NCBI-ProteinID: XP_008830827
LinkDB
Position
Un
AA seq 159 aa
MGKTSSLPTQLFKCCFCDFLKVKMHTMNSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKSQPPSTNKKMKPQRRRKGSPFEERK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaaccagcagtcttccaactcagttatttaagtgctgcttctgtgatttcttg
aaggtaaagatgcacacaatgaactcttcccacctcttctacctggcactctgcttgctc
accttcaccagctctgccacagctggaccagagacactctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttattttaacaagcccacaggctacggc
tccagtagtcggagggcacctcagacaggaattgtggatgaatgctgcttccggagctgt
gatctaaggagactggagatgtactgtgcgcccctcaagcctgcaaagtctgcccgatct
gtccgtgcccagcgccacactgatatgcccaaaactcaaaagtcccagcctccatctaca
aacaagaaaatgaagcctcaaaggagaaggaaaggaagtccatttgaagaacgcaagtag

DBGET integrated database retrieval system