KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733778Help
Entry
103733778         CDS       T03372                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04110  Cell cycle
ngi04213  Longevity regulating pathway - multiple species
ngi04330  Notch signaling pathway
ngi04919  Thyroid hormone signaling pathway
ngi05016  Huntington disease
ngi05034  Alcoholism
ngi05165  Human papillomavirus infection
ngi05169  Epstein-Barr virus infection
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05203  Viral carcinogenesis
ngi05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103733778 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103733778 (Hdac2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103733778 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103733778 (Hdac2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    103733778 (Hdac2)
   05202 Transcriptional misregulation in cancers
    103733778 (Hdac2)
   05203 Viral carcinogenesis
    103733778 (Hdac2)
   05220 Chronic myeloid leukemia
    103733778 (Hdac2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    103733778 (Hdac2)
  09164 Substance dependence
   05034 Alcoholism
    103733778 (Hdac2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    103733778 (Hdac2)
   05165 Human papillomavirus infection
    103733778 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103733778 (Hdac2)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103733778 (Hdac2)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103733778 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     103733778 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103733778 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    103733778 (Hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103733778
NCBI-ProteinID: XP_008830886
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactactacgatggtgacatt
ggaaattattattatggacagggtcatcccatgaaacctcatagaattcgtatgactcat
aacttgttgctaaattatggtttgtacagaaaaatggaaatatataggcctcataaagcc
actgctgaagaaatgacaaaatatcacagtgacgagtacattaaatttctgcggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgcccagtatttgatggactctttgagttttgtcagctctccactggtggctcagttgct
ggggctgtgaagttaaaccggcagcaaactgatatggctgttaactgggctggaggattg
catcatgccaagaaatcagaagcatcgggattctgttacgttaatgacattgtgcttgcc
atccttgagttattaaagtatcatcagagagtcttatatattgatatagatatccatcat
ggtgatggtgttgaggaagctttttacacaacagaccgggtgatgacagtttcattccat
aaatatggagaatactttcctggcacaggagacttgagggatattggtgctggaaaggga
aaatactatgctgtcaattttcccatgagagacggtatagatgatgagtcatatgggcag
atatttaagcctataatctcaaaagtgatggagatgtatcagcctagtgccgtagtatta
cagtgtggtgcagattcattatctggtgacaggcttggttgcttcaatttaactgtcaaa
ggtcatgctaaatgtgtggaagttgtaaaaacttttaacttgccattactgatgcttggc
ggaggtggctacacaatccgtaatgttgctcggtgttggacgtatgagactgcagttgct
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatctgcgtatgttgccacatgcacctggtgtc
caaatgcaagctattccagaagacgctgttcatgaagacagtggagatgaggatggagaa
gacccagacaagagaatttctattcgagcgtcagacaaacggatagcttgtgacgaagaa
ttctcagattccgaggatgaaggggaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagcaaggattgaagaagacaagaaggagacagaggacaagaaaacagat
gttaaggaagaagataaatccaaggacaatagcggtgaaaaaacagataccaaaggagcc
aagtcagaacaactcagcaacccttga

DBGET integrated database retrieval system