KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103733801
Entry
103733801         CDS       T03372                                 

Gene name
Ret
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
ngi05223  Non-small cell lung cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103733801 (Ret)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103733801 (Ret)
   05230 Central carbon metabolism in cancer
    103733801 (Ret)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103733801 (Ret)
   05223 Non-small cell lung cancer
    103733801 (Ret)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103733801 (Ret)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103733801 (Ret)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  RET family
   103733801 (Ret)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD4 RET_CLD1 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 103733801
NCBI-ProteinID: XP_008830906
LinkDB
Position
Un
AA seq 1114 aa
MAKATSGAAGLGLKLFLLLPLLGEAPLGLYFSRDAYRERLYVDQPAGTPLLYVHALRDAP
GEVPSFRLGQYLYGAYRTRLHENDWIRIQEDTGLLYLNQSLNHSSWEQLSIRNGGFPLLT
VFLQVFLGSTALREGECQWPGCARVYFSFINGSFPACSSLQSQDLCLPESGLSFRIRENR
PPGTFHQFHLLPVQFLCPNISVAYRLLEGESLPFYCDPDSLEVSTCWALDRELQEKYVLE
AECIVHNGVSEEKVTVSLPVTVYDEDDSAPTFSRGVDTASAVVEFKRKEGTVVATLHVFD
ADVVPASGELVRRYTSTLLSGDSWAQQTFRVEHSPNEILAQANSSFVRATMHDYKLILNR
SLPISESRVLQLVVLVNDSDFQGPGTGVLLLHFNVSVLPVSLHLPGAYSFSVNRRARRYA
QIGKVCVENCQEFSGIHIQYKLQPSGTNCSALGVVTSAEDTSGTLFVNDTEALQRPECAE
LQYTVVATDRQTRRQAQASLLVTVEGTYIAEEVGCPESCAVSKRRAECEECGGLGSLTGR
CEWRQGDGKGITRNFSTCSPSTRTCPDGHCDAVENRDINICPQDCLRGSIVGGHEPGERR
GIKAGYGICNCFPEEKKCFCEPEDSQGPLCDELCRTVISAAVLFSFIVSVLLSTFCIHRY
HKHAHKPPIASAEMTFCRPAQGFPISYSSSGTRRPSLDSMENQVSVDAFKIPEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKIGPGYVGGGGSRNSSSLDH
PDERVLTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAA
STPSDSLLYDDGLSEEETPLVDCNNAPLPRSLPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTSTGFPRYANDSVYANWMVSPSAAKLMDTFDS
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggcgccgcagggctggggctgaagctgttcttgctgctgcca
ctgctaggcgaagcccctctgggcctctacttctcaagagatgcttaccgggagaggcta
tatgtggaccagccagccggcacacctctgctctatgtccatgccctacgagacgcccct
ggagaagtacccagcttccgcctgggccagtacctctatggtgcctatcgcacacgacta
catgagaatgattggatccgcatccaggaagacactggcctcctctacctcaaccagagc
ctgaaccacagctcctgggaacagctcagcatccgcaatggtggcttccccttgcttaca
gtcttcctccaggtcttcctggggtccacagctctgcgagaaggcgagtgccagtggcca
ggctgtgcccgtgtgtacttctccttcatcaatggctccttcccagcttgcagctctctt
caatcccaggatctctgcctcccagagtcaggcctgtccttccgcatcagggagaacagg
cccccaggcactttccaccagtttcaccttttgcccgtgcagttcctttgccccaacatc
agtgtggcttatagactattagaaggtgagagtctgcccttctattgcgacccagacagc
ctggaggtgagcacttgctgggccctggaccgtgagcttcaagaaaagtatgtgctggag
gccgagtgcatagttcacaatggtgtcagtgaggagaaggtgacagtgtcccttcctgtg
acagtgtatgatgaggacgactcagcgcccaccttctctaggggtgtggacactgccagt
gctgtggtggaatttaagcggaaggagggtactgtggtggccactctgcatgtgttcgat
gcggatgtggtacctgcatccggggagctggtgagacggtacacaagcacactactctca
ggggactcctgggcccagcagaccttccgggtggagcactcacccaacgagatcttggcc
caggccaacagcagcttcgtgcgggcaaccatgcatgattacaagctgattctcaaccgg
agcctgcccatctcagagagcagagtcctgcagctggtggtcctggtcaatgactcagac
ttccaggggcctggaacaggtgtcctcctcctccatttcaatgtgtctgtgttgcctgtt
agcctgcatctgcccggtgcctactccttctctgtgaacaggagggcccgccgttatgca
cagattgggaaagtctgtgtggaaaactgccaggaattcagcggcatccacatccagtac
aagctgcaaccctccggcaccaactgcagtgctctaggtgtggtcacctcagctgaggac
acctcagggaccctgtttgtaaacgacacagaagccctgcagcgacctgaatgtgccgag
ctccagtacacagtggtggccactgaccggcagacccgcaggcaggcccaggcctcgctg
ctcgtcactgtagaggggacgtacattgctgaggaagtgggctgccccgagtcctgtgca
gtcagcaagagacgagctgaatgtgaggagtgcggtggcctgggctctctgactggcagg
tgcgagtggcgtcagggagacggcaaagggatcaccaggaacttctccacctgctccccc
agcaccaggacctgccctgatggccactgtgatgctgtggagaaccgggatatcaacatt
tgcccccaggactgcctccgtggcagcattgttgggggacatgaaccaggggagcgccgt
gggattaaagccggctatggcatctgcaactgcttcccagaggagaagaagtgcttctgt
gagcccgaggacagtcaaggcccgctgtgcgatgagctgtgtcgcacggtgatctcagca
gccgtcctcttctccttcatcgtctcggtcctgctgtccaccttctgcatccaccgctac
cacaagcatgcccacaagccacccattgcttcagcggagatgaccttctgccggcctgcc
cagggctttccaatcagctattcttcctccggcacccgccggccctcactggattccatg
gagaaccaggtttctgtggatgccttcaagattccggaagatccaaagtgggaatttcct
cggaagaacttggttcttgggaaaaccctgggagaaggcgagtttggaaaagtggtcaaa
gcaacagccttccgtctgaaaggcagagcagggtacaccacggtggctgtgaagatgctg
aaagaaaatgcctccccgagtgagttacgagacctgctgtctgagttcaacctgctgaag
caggtcaaccacccacatgtcatcaagttgtatggggcctgcagccaggatgggcctctc
ctcctcattgtggagtacgccaagtatggctccctacgaggttttctccgcgacagccgc
aagattgggccgggctacgtgggcggtggaggcagccgcaattccagctccctagatcac
ccagatgagcgggtgctgactatgggtgacctcatctccttcgcctggcagatctcaagg
ggcatgcagtacttggctgagatgaagctcgtacaccgggacttagcggctaggaacatc
ctggtggctgaggggcggaagatgaagatttctgattttggtttgtcccgagatgtttat
gaagaagattcttacgtgaagagaagcaagggccggattcctgtcaaatggatggcaatt
gagtccctttttgatcacatctacaccactcaaagtgatgtgtggtcctttggggtccta
ctgtgggagattgtgactctggggggcaacccctaccctggaattcctcctgaacgactc
ttcaaccttctgaagacgggccacaggatggagaggccagacaactgcagcgaagaaatg
taccgactgatgctgcaatgctggaagcaggaaccagacaagaggccagtattcgctgac
atcagcaaggacctggagaagatgatggtcaagagcagagactacttggacctggctgca
tccactccatctgattcactgctttatgatgatggcctctcggaagaggagacacccctg
gtggactgtaacaatgctcccctcccgcgctctctcccttccacatggattgaaaacaaa
ctctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgagagcc
gatggcactagcactgggttcccacgatatgcaaatgatagtgtatatgctaactggatg
gtttcaccctcagcggcaaaattaatggacacatttgatagttaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735006
Entry
103735006         CDS       T03372                                 

Gene name
Ncoa4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04216  Ferroptosis
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    103735006 (Ncoa4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103735006 (Ncoa4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103735006 (Ncoa4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 103735006
NCBI-ProteinID: XP_008832330
LinkDB
Position
Un
AA seq 617 aa
MNSLEQTGCFSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLE
CLRSREVWLNEQVDLIYQLKEETLQQQVQQLYWLMGQFSCLIHQLECTQNKDLANQVSVC
LERLSSLALKPEDSTVLLFEADTTALRQTITTFGSLKTIQIPEHLMAHASSSNIGSFLEK
RGYTPVPEQKPASSSTALSLSEWLLVTKPAIGHQAPYVPSTNPQDWLTPKQTLENSQMSA
RACSFFSNAWGDLKGLENWLLNNQQQTFGKLSSPQYNGHSVTSSSSIGIGKMGGGELLGQ
EDTDLSEWLVTREPCDLEKPENGGRESSEKLKLLFQIFREPYSVSDWLVKPGSCTNCQGN
QPRGVEIENLGNLKCLNDHLEAKKPLSVPGTTEPQNQQEPCKIEEVCRANEPCTSFAECV
CDENCEKEAVHRWLLKKEGKDKNGMPVEPTFEPEKHKEFLNMWLCPRKEFMEQAKAPKAI
APARIADSFQVIRNSSLSEWLIRPSCKESGSMEVSSIEDKTGKEKVKSAMTTSWCPLNTA
DWVLPRKNMGNLNQFSSGEDKWLLRKKAQEVFLNSPLQEERNFPPDCYGLPAVCDLFACM
QLKVDKDKWLYRTPLQM
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaactccctggaacagactggctgcttcagtaatagagagacacttttgaggtgcagt
gatgcacggagggagttggaacttgctattggtggagtactccgggctgaacagcaaatt
aaagataacttgcgagaggtgaaagctcagattcacagttgcataagtcgccacctagaa
tgccttcgaagccgagaggtgtggttaaacgaacaagtagacctcatctatcagcttaaa
gaggagacacttcagcagcaggttcagcagctttactggttaatgggccagttcagttgt
cttattcatcaactggagtgtacccaaaacaaagatctcgccaatcaagtctccgtgtgc
ctggagagactgagcagtttggcccttaagcctgaggattcaactgtcctgctctttgaa
gcagatacaactgctctgcgccagaccatcaccacatttggatccctcaagaccattcaa
attcctgagcacctgatggcccatgccagttcatcgaacattggatctttcctagagaaa
agaggttataccccagtgccagagcagaagccagcatccagcagcacagctctttctctc
agtgaatggcttcttgtcaccaaacctgccattggtcatcaggctccttatgtacccagc
accaacccccaggactggctcaccccaaaacagaccttggagaatagtcagatgtctgcc
agagcctgcagtttcttcagtaacgcctggggtgacctgaaaggcttagagaactggctc
ctcaacaaccagcaacaaacctttggaaaactgagttccccacagtataatggccattct
gtcaccagctcttcatccattggaattggaaagatgggaggtggggagctcctcgggcaa
gaagacacagacctgtctgagtggctggtgactcgagaaccctgcgacctggagaagccg
gagaatggtggccgtgaaagcagtgagaagttaaagctcctgttccagatattcagagag
ccgtacagtgtcagcgattggcttgtcaagcctggttcctgtactaactgtcagggcaac
cagcccagaggtgtggagattgaaaacctgggcaatctgaaatgcctgaatgatcacctg
gaggccaagaaaccactgtctgtccctggcaccactgaaccacagaaccagcaggaacca
tgtaaaatagaggaagtctgcagagccaacgagccctgcacaagctttgcggagtgtgtg
tgtgatgagaattgtgagaaggaagctgtgcacagatggcttctgaagaaagaaggaaag
gacaagaatggaatgcccgtggaacccacattcgagcctgagaaacacaaagagttcttg
aatatgtggctctgtcctagaaaagagttcatggaacaagctaaggcaccaaaggcaatt
gctcctgctagaattgctgattccttccaagtcataaggaacagttccttgtcagaatgg
cttatccggccctcatgcaaagagagtggctccatggaagtgtctagcattgaggacaaa
actggcaaagaaaaggtgaaaagcgctatgacgacctcctggtgtcctttaaacactgct
gactgggtcttaccaagaaagaacatgggaaatctcaaccagttttcttctggtgaagac
aagtggctacttcgaaaaaaggcccaggaagtgtttcttaattcacctctacaagaggaa
cgtaactttccccctgactgttacggcctgccagcagtttgtgatctctttgcctgtatg
cagcttaaagttgataaagacaagtggttatacagaactcctctacagatgtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103746557
Entry
103746557         CDS       T03372                                 

Gene name
Ccdc6
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi05200  Pathways in cancer
ngi05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103746557 (Ccdc6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103746557 (Ccdc6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 103746557
NCBI-ProteinID: XP_008847000
LinkDB
Position
Un
AA seq 444 aa
MQSSCSATSGGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQENKVLKIELETYKLK
CKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTN
ELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLE
NTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIR
FLKNEVERLKQQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCRQLS
ESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPT
SLTRAGMSYYNSPGLHVQHMGTAHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPP
PPPPPMQPTVPSAGTSQPTPPSQP
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcagtcgtcctgctcggcgacctcgggcggcggcggcggcggcgggggcggcggcgga
gggaagtcggggggcattgtcatctcgccgttccggctggaggagctcaccaaccgcctg
gcctcgctgcagcaggagaacaaggtgctgaagatcgagctggagacctacaaactcaag
tgcaaggcgctgcaggaggagaaccgcgacctgcgcaaagccagcgtgaccatccaagcg
cgggcggagcaggaagaagaattcatcagcaacactttattcaagaaaattcaggccttg
cagaaggagaaagaaactcttgctgtgaattatgaaaaggaggaagagtttctcaccaat
gagctctcccgaaagctgatgcagttgcagcatgagaaggcggagctggagcagcatctg
gagcaggagcaggagtttcaggtcaacaagctgatgaagaagattaagaagctcgagaac
gacaccatatccaagcagctcaccttggagcagttgagacgggagaagattgaccttgaa
aacaccttggaacaagagcaagaggccctggtcaatcggctgtggaaaaggatggacaag
ctggaggccgaaaaacgaatcctgcaggagaaattagaccagcctgtctctgccccacca
tcgcctagagatatctccatggagatcgattccccggaaaacatgatgcggcacatcagg
tttctgaagaatgaagtggagcggctgaagcagcagctgagagctgcacagctgcagcat
tcagagaagatggcccagtatctggaggaggaacggcacatgagggaagaaaacttgagg
ctgcagagaaagctccagcgggagatggagaggagggaagcgctctgtcgccagctgtca
gagagcgagtccagcttggagatggatgacgagaggtattttaatgaaatgtctgcacaa
ggattaagacctcgcactgtgtccagccccatcccttacacgccttctccgagttcaagc
aggcctatatcaccaggtctgtcatatgcaagtcacacggttggcttcacaccacccacc
tcgttgactcgagccggaatgtcttactacaactctccgggcctccatgtacagcacatg
gggacggcccacggcattacaaggccttcaccacggagaagcaacagtcccgacaagttc
aaacggcccacaccgcctccatctcccaacacacagaccccagtccagccgcctccacca
ccgcctccaccgcccatgcagcccacagtgccctcggcaggcacctcgcagcccacccct
ccctcccagccttaa

DBGET integrated database retrieval system