KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734016
Entry
103734016         CDS       T03372                                 

Gene name
Nfkbia
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04024  cAMP signaling pathway
ngi04062  Chemokine signaling pathway
ngi04064  NF-kappa B signaling pathway
ngi04210  Apoptosis
ngi04380  Osteoclast differentiation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04623  Cytosolic DNA-sensing pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04657  IL-17 signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04668  TNF signaling pathway
ngi04722  Neurotrophin signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04926  Relaxin signaling pathway
ngi04931  Insulin resistance
ngi05132  Salmonella infection
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05162  Measles
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05203  Viral carcinogenesis
ngi05215  Prostate cancer
ngi05220  Chronic myeloid leukemia
ngi05222  Small cell lung cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103734016 (Nfkbia)
   04668 TNF signaling pathway
    103734016 (Nfkbia)
   04024 cAMP signaling pathway
    103734016 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103734016 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103734016 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    103734016 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    103734016 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    103734016 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    103734016 (Nfkbia)
   04660 T cell receptor signaling pathway
    103734016 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    103734016 (Nfkbia)
   04659 Th17 cell differentiation
    103734016 (Nfkbia)
   04657 IL-17 signaling pathway
    103734016 (Nfkbia)
   04662 B cell receptor signaling pathway
    103734016 (Nfkbia)
   04062 Chemokine signaling pathway
    103734016 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103734016 (Nfkbia)
   04926 Relaxin signaling pathway
    103734016 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103734016 (Nfkbia)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103734016 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734016 (Nfkbia)
   05203 Viral carcinogenesis
    103734016 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103734016 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103734016 (Nfkbia)
   05215 Prostate cancer
    103734016 (Nfkbia)
   05222 Small cell lung cancer
    103734016 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103734016 (Nfkbia)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103734016 (Nfkbia)
   05135 Yersinia infection
    103734016 (Nfkbia)
   05134 Legionellosis
    103734016 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103734016 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    103734016 (Nfkbia)
   05161 Hepatitis B
    103734016 (Nfkbia)
   05160 Hepatitis C
    103734016 (Nfkbia)
   05171 Coronavirus disease - COVID-19
    103734016 (Nfkbia)
   05164 Influenza A
    103734016 (Nfkbia)
   05162 Measles
    103734016 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    103734016 (Nfkbia)
   05163 Human cytomegalovirus infection
    103734016 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103734016 (Nfkbia)
   05169 Epstein-Barr virus infection
    103734016 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103734016 (Nfkbia)
   05140 Leishmaniasis
    103734016 (Nfkbia)
   05142 Chagas disease
    103734016 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103734016 (Nfkbia)
   04131 Membrane trafficking [BR:ngi04131]
    103734016 (Nfkbia)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103734016 (Nfkbia)
Membrane trafficking [BR:ngi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103734016 (Nfkbia)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 103734016
NCBI-ProteinID: XP_008831131
LinkDB
Position
Un
AA seq 314 aa
MFQPAEHGQEWAMEGLRDGLKKERLVDDRHDSGLDSMKDDEYEQMVKELREIRLEPQEAP
LGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPAIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTPQHLHSILQATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTMENLQMLPESDDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccagccgagcacggccaggagtgggccatggagggcctgcgggatggcctg
aaaaaggagcggttggtggatgaccgccacgacagcggcctggactccatgaaggacgac
gagtacgagcagatggtgaaggaactgcgtgagatccgcctggagccgcaggaggcgccg
ctgggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg
gccatcattcatgaagagaaggccctgaccatggaagtgattcgtcaggtgaagggagac
ctggccttcctcaacttccagaacaatctgcagcagactccactccacttggctgtgatc
accaaccaaccagcaattgctgaggcacttctggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctgcaccttgcctgtgagcagggctgcttggccagtgta
ggagtcctgacacagacctgcacgccccagcatcttcactccatcctgcaggccaccaac
tacaatggccacacgtgtctgcacttagcttctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgcagatgtcaatgctcaggagccctgtaatggccggacagcc
ctccatcttgcagtggacctgcagaatcctgacctagtgtcactcttgttgaagtgtggg
gctgatgtcaacagagttacctatcaaggctactccccctaccagcttacctggggccgc
ccaagcacccggatacagcagcagctgggtcagctgactatggagaatcttcagatgctc
cccgagagtgatgatgaggagagctatgacacagagtctgagttcacggaggatgagctg
ccctatgatgactgtgtgtttggaggccagcgtctgactttataa

DBGET integrated database retrieval system