KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734199
Entry
103734199         CDS       T03372                                 

Gene name
Dapk1
Definition
(RefSeq) death associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04140  Autophagy - animal
ngi05200  Pathways in cancer
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103734199 (Dapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734199 (Dapk1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103734199 (Dapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103734199 (Dapk1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103734199 (Dapk1)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   103734199 (Dapk1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death COR Kdo RIO1 O_Spanin_T7 AAA_29 ABC_tran APH Choline_kinase AAA_23 RsgA_GTPase DUF3847 Env-gp36
Other DBs
NCBI-GeneID: 103734199
NCBI-ProteinID: XP_008831315
LinkDB
Position
Un
AA seq 1442 aa
MTVFKQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPRPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEF
FSNTSVLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPFDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEET
PLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAC
DKDGHIALHLAVRRCQMEVIKTLLSYGCFVDFQDRHGNTPLHVACKDGSTPIVMALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTSDGKTAEDLAKSEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLAAKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIISGCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFMYDVQDQLNPLASEDDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTSVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDMSSGTMVDVPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHITPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRITNRGAELLVLLVNHGQGIEVQVRG
LETEKIKCYLLLDSVCSTIENVMASTLPGLLTVKHYLSPQQLREHHEPLMVYQPRDFFRA
QTLKESALTNTMGGYKESFSSIICFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNTRAPRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLEGNGQEAYASSCNSGTSYNSISSVVSRRNSHAWTSLY
DL
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgactgtgttcaagcaggaaaacgtggatgattactacgataccggcgaggaacttggc
agcgggcagttcgcagttgtgaagaaatgccgggagaaaagcactggtctccagtatgcg
gccaagttcatcaagaaaaggaggaccaaatccagccgccggggtgtgagccgtgaggac
atcgagcgggaggtcagcatcctgaaggagatccagcaccccaatgtcatcaccctgcac
gaggtctacgagaacaagaccgatgtcattctgattctggagctcgttgcaggtggtgag
ctgtttgacttcctagctgagaaggaatctttgactgaagaggaagcaactgaatttctc
aaacagattcttaatggtgtttactacctccactcccttcagatcgcccacttcgacctt
aagcctgagaacataatgcttttggatagaaatgttcccagaccccggatcaagatcatt
gactttggcttggcccataaaattgactttggaaatgaattcaaaaacatattcgggaca
ccagagtttgtggctcctgagatagtcaactatgaaccccttggtctggaggcggacatg
tggagtattggagtgataacctatattctcctaagtggggcttccccatttcttggagac
actaaacaggagacattagcaaatgtatctgctgtcaactacgaatttgaggaagaattc
ttcagtaataccagtgtccttgccaaagatttcatcagaagactactggttaaggatcca
aagaagagaatgacaattcaagatagtttgcagcacccctggatcaagcctaaagataca
caacaagcacttagtcgaaaagcttcagcagtaaacatggagaaatttaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcgttcttgtccagaagtaacatgagtgtggccagaagcgatgatactctggatgaggaa
gactccttcgtgatgaaagccatcatccatgccatcaatgatgacaacgtcccaggcctg
cagcaccttctgggctccttgtccaactatgatgtgaaccaacccaacaagcatggaaca
cctccgttactgattgctgctggctgtgggaatatccagatactacagttactcataaaa
agaggctcaagaattgatgtccaggataagggaggatccaatgccatctattgggcctca
cggcatggccacgtggacactttgaaattcctcaatgagaacaaatgccctttcgatgtt
aaagacaagtctggagagacagcccttcatgtggcagctcgctatggccatgcggacgtg
gttcagctcctgtgtagctttggttcgaatcccaatttccaggacaaggaagaagaaacc
ccactgcactgtgctgcctggcatggctattactctgtggccaaagccctttgtgaagtt
ggctgtaatgtgaacatcaagaatcgtgagggagagacccccctgctgacagcgtccgcc
aggggctaccatgacattgtggagtgtctggctgaacacggagctgaccttaatgcctgt
gacaaggatggacacattgctcttcatcttgctgtgaggcgttgtcagatggaggtcatc
aagaccctccttagctatgggtgtttcgtggatttccaggacaggcatggcaacacaccc
ctgcatgtggcctgcaaagatggcagcacacctatcgtgatggccctctgtgaagctagc
tgcaatttggacatttcaaacaagtatggacgaactcctctccaccttgcagccaacaat
gggatcctggatgtggtccgctacctctgtctgatgggtgccaatgtggaggccctgacc
tcggatggcaagacggcagaggaccttgccaagtcagagcagcacgagcatgtggcagga
ctcctggcaagactccgaaaggacacacaccgaggactcttcatccagcagctccgaccc
acacagaacctccagccaagaatcaagctcaagctgtttggccactcggggtccgggaaa
tccactctggtggaatctctcaagtgtgggctgctccggagctttttccgaagacgcagg
cccagactctcctctaccaactccacccggttcccaccatcaccgctggctgcaaagcct
acagtctccgtgagcattaacaacctgtaccctggctgtgagaatgtgagcgtgaggagc
cggagcatgatgttcgagccaggcctcaccaaagggatgctggaggtgtttgtggcgcca
tcccaccacctgcactgctcagctgatgaccagtccaccaaagccatcgacatccagaat
gcttatttgaatggagttggcgacttcagtgtgtgggagttctccggaaaccccgtgtac
ttctgctgctatgactactttgctgccaatgaccccacatccattcatgtcatcgtcttc
agcctggaagagccctatgagatccagctaaaccaagtgattttctggctcagtttcctg
aagtctctggtcccggttgaggagcccatagcattcggcggcaagctgaagaacccactt
cgagttgtcctggtggccacccatgctgacatcatgaatatccctcgacctgctggaggc
gagtttggatacgacaaggacacttccttgctgaaagagatcaggaacaggttcgggaat
gatcttcacgtctcaaataagctctttgtgctggatgcaggagcttctgggtctaaggac
attaaggtccttcggaatcacctgcaagaaattcggagtcagatcatctctggctgccct
cccatgactcacctatgtgagaaaatcatctccacgctgccttcctggcggaagctcaat
gggccaaaccagctgatgtcactgcaacagttcatgtacgatgtgcaggaccaactgaac
cccctggcctctgaggatgacctcaggcgcatcgcacagcagctgcacagcacgggcgag
atcaacatcatgcagagtgaaactgtgcaggatgtcctgctcctggaccctcgatggctt
tgcaccagcgtcctggggaagctgctgtctgtggagacgccccgggccttgcatcattac
cgtggccgctacaccatggaggacatccagcgcctggtccccgacagtgatgtggaggaa
ctgttgcagatcctggacgccatggacatctgtgcccgagacatgagcagtgggaccatg
gtagacgttcctgctcttatcaagacagatagcctgcagcgttcctgggctgatgaagag
gatgaggtgatggtgtatggtggtgtgcgcatcgtccctgttgagcatataacccccttc
ccatgtggcatctttcacaaagttcaggtgaacctgtgcaggtggatccaccagcagagt
gccgagggcgatgcagacatccgcctgtgggtgagtggctgcaggatcaccaaccgtggg
gctgagctgctggtgctgctggtcaaccacggccagggtatagaggtgcaggtgcgtgga
ctggagacagagaagatcaaatgctacctgctgctggactcggtgtgcagcaccattgag
aatgtcatggccagtaccttgccggggctgctaacggtgaagcactacctgagcccccag
cagctgcgggagcaccacgagccactcatggtctaccagccacgggacttcttccgggca
cagaccctgaaggagagtgccctgaccaacaccatgggagggtacaaggagagcttcagc
agtatcatctgcttcgggtgtcatgatgtctactcgcaggccagtctcggcatggacatc
catgcatcagacctgaacctcctgactcggaggaaactcagtcgcctgcttgacccacct
gaccccatggggaaggactggtgccttcttgccatgaacttaggcctcccagatctggtg
gccaagtacaataccaacaccagggctcccagggattttcttcccagcccggtgcatgcc
ttgctacaggaatggacctcctaccccgagagcacagtgggcatcctcatatctaaactg
cgggagctcgggcgccgggatgctgctgactttttactgaaggcctcctctgtattcaag
atcaacctcgaaggcaacggccaggaggcctatgcctcaagctgcaacagtggcacgtct
tacaattccattagctcggtggtgtcccggagaaactcccatgcttggacctcactgtat
gatttataa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737271
Entry
103737271         CDS       T03372                                 

Gene name
Dapk3
Definition
(RefSeq) death associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04140  Autophagy - animal
ngi05200  Pathways in cancer
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103737271 (Dapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737271 (Dapk3)
  09162 Cancer: specific types
   05219 Bladder cancer
    103737271 (Dapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103737271 (Dapk3)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103737271 (Dapk3)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   103737271 (Dapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase
Other DBs
NCBI-GeneID: 103737271
NCBI-ProteinID: XP_008835295
LinkDB
Position
Un
AA seq 454 aa
MSTFRQEDVEEHYEMGEELGSGQFAIVRKCRQKTTGREYAAKFIKKRRLSSSRRGVSREE
IEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRGARSEDSGRRPERRRLKTT
RLKEYTIKSHSSMPPNNSYASFERFSKVLEEVAAAEEGLRELQRGRSRCREDVAALQAAA
EQREARMRDGSAGLGRDLRRLRQELLRSEALRRQAQDEARAAVQGAGGLKWRLGRLEKRY
DALAAQLASEMRFVRDLVQALEQEKREAGDCGLR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtccacgttcaggcaggaagatgtagaggagcactatgagatgggagaggagttgggc
agtggtcagttcgccatcgtgcgcaaatgccggcagaagacaacaggcagggagtatgcg
gccaagttcatcaagaagcggcgcctgtcatctagccggcgtggcgtgagccgggaggag
attgagcgggaggtgagcatcctgcgcgagatccgccaccccaacattatcactctgcac
gatgtgtttgagaacaagacagatgtggtactgatcctggagctggtgtcgggtggtgag
ctcttcgatttcctggccgagaaggagtcgctgactgaggatgaggccacgcagttcctc
aagcagatccttgatggagtccactacctgcactccaagcgtatcgcccactttgacctg
aagcccgagaacatcatgctgctggacaagcatgctgccagcccgcgcatcaaactcatt
gactttggcatcgcacacaagattgaggctggcaatgagttcaagaacatttttggcaca
ccagagttcgtagcccccgagattgtcaactatgagccactgggcctggaggctgatatg
tggagcattggggtgatcacctacattctcctgagtggggcatctccgttcctgggtgag
accaagcaggagacactgaccaacatctcagctgtgaactacgacttcgacgaggaatac
ttcagcagcaccagcgagttggccaaggacttcatccgcaggctgcttgtcaaagacccc
aagaggaggatgaccatcgcccagagtctggagcactcctggatcaaggccatccggcgg
cgtggggcgcgcagcgaggacagtgggcggcggccagagcggcggcggctgaagaccacg
cggctgaaggaatacaccatcaagtcgcactccagcatgccgcccaacaacagctacgcc
agcttcgagcgcttctccaaggtgctggaggaggtggctgcggccgaggaggggctgcgg
gagctgcagcgcgggcgcagccgctgtcgggaggacgtggcggctttgcaggcggcagcg
gagcagcgggaggcgcgcatgcgcgatggcagcgcggggctgggccgtgacctgcggcgc
ctgcggcaggagttgctgcgctccgaggccctgcggcggcaggcacaggacgaggcccgt
gcagctgtgcagggcgccggcggcctcaaatggcgcctcggtcgcctggagaagcgctac
gacgcgctggccgcacagctggcatccgagatgcgcttcgtgcgcgacttggtgcaggcg
ctggagcaggagaagcgggaggccggggactgcgggctgcgctag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750086
Entry
103750086         CDS       T03372                                 

Gene name
Dapk2
Definition
(RefSeq) death associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04140  Autophagy - animal
ngi05200  Pathways in cancer
ngi05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103750086 (Dapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103750086 (Dapk2)
  09162 Cancer: specific types
   05219 Bladder cancer
    103750086 (Dapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103750086 (Dapk2)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103750086 (Dapk2)
Protein kinases [BR:ngi01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   103750086 (Dapk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kdo Kinase-like Glycos_trans_3N
Other DBs
NCBI-GeneID: 103750086
NCBI-ProteinID: XP_017658652
LinkDB
Position
Un
AA seq 291 aa
MQPSSLRSVIARPAGEVCAGRKSSGRVSGGELFDFLAQKESLSEEEATNFIKQILDGVNY
LHSKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIV
NYEPLGLETDMWSIGVITYILLSGASPFLGDTKQETLANITAVSYNFDEEFFSQTSELAK
DFIRKLLVKETRKRLTIQEALRHPWIMPVDNQQAMVRRESVVNLENFKKQYVRRRWKLSF
SIVSFCNHLTRSLMKKVQLGTSEDLRNCESDAEEDIARRKALHPRRRSSTS
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcagccaagttcattaagaagcgtcatagccaggccagccggcgaggtgtgtgccggg
aggaaatcgagcgggagagtatctggaggagaactgttcgattttctggcccagaaggag
tcactaagtgaagaggaggccaccaacttcattaagcagatcctggatggggtaaactat
cttcactcaaagaaaattgctcactttgatctcaagccagaaaacattatgttgttagac
aagaatattcccattcctcacatcaaactgattgactttggcctggctcatgaaatagaa
gatggagttgaatttaagaacatttttgggacaccagaatttgttgctccagaaattgtg
aactatgagccactgggcctggagactgacatgtggagcatcggtgtcatcacctacatc
ctccttagtggagcatcccctttcctgggagacacaaagcaggaaacattggcaaatatc
acagcagtgagttacaactttgatgaagaattcttcagccagacgagtgagctagccaaa
gacttcattcggaagcttcttgttaaagagactcggaaacggctcaccatccaagaggct
ctcagacatccctggatcatgccagtggacaaccagcaagccatggtacgcagggagtct
gtggtcaacctggagaactttaagaagcagtatgtccgcaggcgttggaagctctccttc
agcattgtgtccttctgcaaccaccttacccgttccctgatgaagaaggtacagctgggg
acaagcgaggacctgaggaactgtgagagtgacgctgaagaggacattgccagaaggaaa
gcccttcacccccggaggaggagcagtacctcctaa

DBGET integrated database retrieval system