KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734373
Entry
103734373         CDS       T03372                                 

Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00280  Valine, leucine and isoleucine degradation
ngi00350  Tyrosine metabolism
ngi00380  Tryptophan metabolism
ngi00750  Vitamin B6 metabolism
ngi00760  Nicotinate and nicotinamide metabolism
ngi00830  Retinol metabolism
ngi00982  Drug metabolism - cytochrome P450
ngi01100  Metabolic pathways
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103734373
   00350 Tyrosine metabolism
    103734373
   00380 Tryptophan metabolism
    103734373
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    103734373
   00760 Nicotinate and nicotinamide metabolism
    103734373
   00830 Retinol metabolism
    103734373
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    103734373
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734373
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     103734373
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 103734373
NCBI-ProteinID: XP_008831514
LinkDB
Position
Un
AA seq 1343 aa
MPSPSNSDELIFFVNGKKVIEKSADPETSLLSFVRKVLRLTGTKYGCGGGGCGACTVMVS
RYDPKSKKIHHYPATACLVPICSLHGAAITTVEGVGSIKKRVHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITEALGGNLCRCTGYRPIVESGKTFCGESTVCQMKGSG
KCCMDQDEGSFVSREEKMCTKLYNEDEFQPFDPSQEPIFPPELIRMAEDPNKRRLTFQGE
RTTWIMPATLKDLLELKASYPKAPLVMGNTTVGPNIKFKDEFYPVFISPLGLPELYFVNT
TNDEVTIGAGYSLAQLNDALYFIVSDQPKEKTKTYHALLKHLRTLAGPQIRNMATLGGHV
VSQPNFSDLNPILAAGNATINVISKEGTRQIPLNGPFLEGSPEANLRPEEVVLSISIPYS
TQWHFVSGLRMAQRQENAFAIVNAGMSVKFEEGTNTIKDLQMFYGHVGPTVVSASQTCKR
LIGRQWDDQMLSEACRWVLEEIRIPPAAEGGMVEFRRTLIISLLFKFYLKVRRGLNKMVN
DFSGSLDPQKFPDIPENFVSALDDFPIQTPQGIQMFQCVDPKQPQQDPVGHPVMHQSAIK
HATGEAVFVDDMPPIDQELFLAVVTSTRAHAKILSIDISEALACPGVVDVITAEDVPGDN
NHSGEILYAHNEVICVGQIICTVAADTYAHAKAAAKQVKIAYEDIEPKIITIEQALAHNS
FLSDERKIEQGNVEHAFENVDQIIEGEVHVEGQEHFYMETQTILAIPKAEDKEMVLHLGT
QFPTHVQEYVAAALKVPRSRIACHMRRTGGAFGGKVTKPALLGAVSAVAANKTGHPIRFI
LERGDDMLITAGRHPLLGKYKIGFMNNGEIKAADVEYYINGGCTPDESELVMEFIVLKSE
NAYYIPNFRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYISAVAAKCNLLPEEVKEINM
YKRTSKTAHKQTFNPEPLRRCWKECLEKSSFYARKQAAEEFNKKNFWKKRGLAVVPMKFT
IGIPIAFYNQAAALVHIYLDGSVLLTHGGCELGQGLHTKMIQVASRELNIPQSYVHLSET
STITVPNAIFTAGSMGTDINGKAVQNACQILLDRLQPIIKKNPKGKWEEWIGKAFEESIS
LSATGYFKGYQTNMDWEKEEGDAYPYYVYGASFSEVEVDCLTGAHKLLRTDIFMDAAFSI
NPALDIGQVEGAFIQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVTEIPEEISVTLVHS
QNPIAIYSSKGLGEAGMFLGSSVLFAIYDAVSAARRERGLSNTFPLNSPATPEVIRMACV
DQFIDMIPSDDPSTFTPWSIHVS
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgccttcgccttccaattctgacgagctgatattttttgtgaatggaaaaaaggtcata
gagaagagtgctgaccctgaaacgtctctactgtccttcgtgaggaaagttctacgcctc
acaggcactaaatatggctgtggaggaggaggctgcggagcctgtacggtgatggtgtca
agatacgaccccaagagcaagaagatccaccactacccagcaacagcatgcctggtgccc
atctgttctctgcatggagcagccatcaccaccgtggaaggtgtgggaagcatcaaaaag
agggttcatcctgtgcaggaacggcttgccaagtgtcatggcacacagtgtggattctgc
agtcccgggatggtgatgtccatctacacactgctcaggaaccaccctgaaccgacgcct
gaacagatcactgaagctcttggaggtaatttgtgccgatgtactggatatcgaccaatt
gtagaaagtgggaaaactttctgtggggaatctactgtgtgccaaatgaaaggatcagga
aaatgctgcatggaccaagacgaggggtcttttgtgagcagagaggaaaagatgtgtacc
aaactgtataatgaagatgaattccagcccttcgatccatcccaggaacctatatttcct
cctgaactgatccgaatggcagaagacccaaataagcggaggctgacattccaaggggag
aggaccacctggatcatgcctgcgaccttgaaggaccttctggaactgaaagccagttac
cccaaagccccacttgtcatggggaacaccacagtgggacccaatattaaattcaaagat
gaattctatccagtttttatatccccacttggacttccggaactatattttgtgaacacc
acaaatgatgaggtgacaataggggcaggatacagcctggcgcagttgaacgatgcctta
tattttattgtttcggatcaaccaaaggagaagaccaagacctatcatgccctcctgaag
catctgaggacacttgcaggaccccagattaggaatatggctactttgggaggacatgtg
gtaagccaacctaatttttctgacctaaatcccattttagcagcaggaaacgctaccatc
aatgtgatatctaaagaaggaactcggcagattcctttaaatggccctttccttgagggc
tcccccgaggccaacctgagaccagaagaggttgtgctgtccatttccattccttattcc
actcagtggcactttgtgtcagggcttcggatggcacaacgtcaggaaaatgcctttgcc
attgtcaatgctggcatgagtgtgaaatttgaagaaggcacgaacacaatcaaagatctt
caaatgttctacggacacgttggccccactgttgtctctgcaagccaaacatgcaagcgg
ctcatcgggaggcagtgggatgaccaaatgctgagtgaggcatgcagatgggttctggag
gagatccgcattccaccagcagctgagggtggcatggtggaatttcggaggaccctcatc
atcagcctactcttcaaattctacctcaaagtgcggcgagggctgaacaaaatggtaaat
gacttctctgggtccctggatcctcagaagtttcctgatatcccagaaaatttcgtgagt
gctctggatgacttccccatacaaacaccccaaggaattcagatgttccagtgtgtggat
cccaaacaaccccaacaagatccagttggacacccagtcatgcaccagtcggccattaaa
catgccacaggagaagctgtatttgttgatgacatgcctcccattgaccaagaactcttc
cttgctgtagtaaccagtaccagagctcatgcaaagatcttatcaattgatatttcagaa
gccctggcatgtccaggtgtggttgatgtgattacagctgaggatgttccaggagataat
aaccacagtggagagattttatatgcacataatgaggtaatttgcgtgggtcagatcatc
tgcaccgtggctgcggatacctatgctcatgcaaaagccgcagccaaacaagtgaagatt
gcttatgaagacatagagccaaagattatcacaatagagcaagccctagcacacaattct
tttctttctgatgagagaaaaattgagcaaggaaacgtagagcatgcctttgaaaatgtg
gatcaaatcattgaaggtgaggtccatgtggaaggtcaggagcatttttacatggaaaca
caaactattctggctatccccaaagcagaagacaaagaaatggtgttacacctgggaaca
cagtttccaacccatgtgcaggagtacgtggctgcagcactaaaggtcccaaggagtaga
atcgcctgtcatatgagaagaactggaggagcatttgggggcaaagtgaccaagcccgct
ctgctgggagctgtcagtgctgtggctgccaacaagactggccacccaatccggtttatc
ctagagcgtggtgatgacatgctgataactgctggccgccaccctctcctgggaaaatac
aaaatcgggttcatgaacaacggggagatcaaggctgctgacgttgagtattacatcaat
ggagggtgcactcctgatgagtctgagctggtgatggagtttattgtgctgaaatctgaa
aatgcatattatattccaaatttccggtgccggggcagggcctgcaaaacaaatttgcca
tctaacacggccttccgaggatttggcttccctcaggctacggtggtagtagaagcttac
atcagtgctgtggcagctaaatgtaacctactccctgaagaggttaaagaaataaacatg
tataagagaactagcaaaacagctcataagcagacatttaatccagaacccttgcgaaga
tgctggaaagaatgtctggagaagtcatcattctatgcaaggaaacaggctgcagaggaa
tttaacaaaaagaacttctggaagaagagggggcttgctgtcgtccccatgaagtttacc
attggaatccccatagccttctacaatcaggcagctgctctggtccacatctacttagat
ggctctgtcttgctgactcatggtggctgtgaactgggacaaggcctacacaccaaaatg
attcaagtggctagtcgagaactgaacatcccccagtcctacgtgcacctgtctgaaaca
agcaccatcacggtgcccaatgccatcttcacagcaggctccatgggaacagacatcaac
gggaaggctgtgcagaatgcctgccaaattcttctggaccgtcttcagccaatcatcaag
aaaaaccctaaaggaaaatgggaggaatggattggaaaagcctttgaagaatccatcagt
ctctcagccactggatatttcaaaggctaccagacaaatatggactgggaaaaggaggaa
ggtgatgcctacccatactatgtttatggtgcatccttttctgaggttgaagtggactgt
ctgactggggctcataagctcctgagaactgatatcttcatggatgctgctttcagcata
aaccctgccctggatatcggacaggttgagggtgcatttatccaaggcatgggattctat
accatagaagaactgaaatactccccggaaggtgtgctctattctcggggtccagatgac
tacaaaatccccacggtcactgagataccagaagaaatctcggtcactctggtgcactct
caaaatcccatagccatatactcatccaagggattgggtgaggctggaatgttcttgggg
tcctcagtgttgttcgctatatatgacgcagtgagtgctgcccgcagagagaggggcctg
agcaataccttccccttgaatagcccagcaacacctgaagtcattcgcatggcctgtgtg
gatcagtttattgacatgattcccagtgatgacccttcaacctttactccgtggtccatc
catgtgtcttag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734384
Entry
103734384         CDS       T03372                                 

Definition
(RefSeq) aldehyde oxidase 3-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00280  Valine, leucine and isoleucine degradation
ngi00350  Tyrosine metabolism
ngi00380  Tryptophan metabolism
ngi00750  Vitamin B6 metabolism
ngi00760  Nicotinate and nicotinamide metabolism
ngi00830  Retinol metabolism
ngi00982  Drug metabolism - cytochrome P450
ngi01100  Metabolic pathways
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103734384
   00350 Tyrosine metabolism
    103734384
   00380 Tryptophan metabolism
    103734384
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    103734384
   00760 Nicotinate and nicotinamide metabolism
    103734384
   00830 Retinol metabolism
    103734384
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    103734384
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734384
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     103734384
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Fer2_2 Ald_Xan_dh_C CO_deh_flav_C Fer2 Dicer_dimer
Other DBs
NCBI-GeneID: 103734384
NCBI-ProteinID: XP_008831535
LinkDB
Position
Un
AA seq 1334 aa
MPQSKESDELIFFVNGRKIIEKNTDPEVNLLFYLRKVIRLTGTEYGWGGGDCGACTVMIS
RYDPISKKISHFSVTACLVPICSLHGAAVTTVEGIGSTKSRIHPVQERIAKGHGTQCGFC
TPGMVMSIYTLLRNHPEPSTEQLMETLGGNLCHCTGYRPIVESAKSFIPSSSCCQMNGEW
KGCLDKEKNKLESKISVCTKLYEKEEFQLLDATXELIFPPELMRMAEDPQKKVLMFYGER
TTWIAPGTLKDLRELKMKHPSAPLVMGNTSLGLDLKFRNVSYPVIISPSRILELFVVTNT
KEGLTLGAGISLAQVKDILADVASKLPKERTQTYCALLKHLRTLAGQQIRNMASPGGHII
SRLPTSDLNPVLGVGNCILNVASTEGTQQIPLNDHFLVGAAHASLKPEQVLVSVFIPVSK
KWEFVSAFRQAPRQQNALAISNAGMRVLFKEDTNTIVDLSISYGGVGTTTVSVNKACQKL
IRRCWDEGLLNEACRLVLEEISLPASAPGGMVECQTLTISFLFRFYLDVLQQLKIRIKMS
SLFQDPHGYPDISKKLLNILEDFPLTMPHRMQSFEGVDPQQSLQDPVRCPIMHQSGIKHS
TGEAVFCDDMPVLAEELFLAVVTSNRPHARIISLDASEALASPGVVDVITAQDVPGENGR
DEESLYAQDEVICVGQIVCAVAAHSAKKAAKKVKIVYQDVEPVIVTVQDALXSFIGPEKN
LEQGNVQAAFQCVDQVLEGEVHFGGQEHFYVEIQSIRVVPRAEDKEMDIYVSSQDEAFTQ
EMAAHTLGIPKNRINCHVKRVGGAFGGKSSKPGLLAAMAAQKTGCPIRFVLECGDDMLIT
GGRHPLLGRYKIGFMNNGKIEAADIEFYINGGCTPDDSELVIEYALLKLENTYKISNLHV
XGHVCKTNLPSNTAFRGFGFPQRAFVTETWVSAVAAKCHLPLEKVRELNMYKTIDRTIHK
QEFDPKNLIKCWEKCMEDSSYYSRKKAVEKFNQQSFWKKRGIAIIPMKFSVGYPKTFYYQ
AAALVHIYTDGSVLVAHGGVELRQGINTKMIQVASCELKIPVSYIHLDEMNTVTMPNTIA
TAASTRANVNGRAVQNACQSLMKHLEPIINQNPNGTGEVWVNEAFTQSISLPATGYFRGY
KADMDWEKGEGNTFPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDASFSINPAVDTGQIE
GAFVQGLGLYTPEELKYSPEGVLYTRGPNQYKIPSITDVPEEFHVSLLTPTQNPKAIYSS
KGLGEAGMFLGSSVFFAIADAVDAARKERGLPPVWVMNSPATPELIRMSRVDQFTDQVPX
MDSKCCKPWSIPVA
NT seq 4005 nt   +upstreamnt  +downstreamnt
atgcctcagtctaaggagtcagatgaacttattttctttgtgaatggaagaaaaatcatt
gagaagaatacagaccctgaagttaatttattgttctacttgagaaaagtcatccgactc
acagggacagagtatggctggggaggaggtgactgtggtgcctgcacagtgatgatctca
agatacgaccccatctccaaaaagatcagtcacttctctgtcactgcctgcctggtcccc
atctgttctctccatggagctgctgtcacgactgtggaaggcataggaagcaccaagtcc
aggattcaccctgtccaggaaaggattgccaaaggccatggtacccagtgtggattctgt
actccaggtatggtgatgagcatctacactctcctgaggaaccatccagagccctccaca
gaacagttaatggaaaccttgggtggtaacttatgccactgcactggatacagacccatt
gtggagagtgcaaaaagtttcatccctagttcatcttgttgccaaatgaatggggaatgg
aaaggttgcttggataaagaaaaaaacaagctggagagcaaaatcagtgtttgcaccaag
ttgtatgaaaaagaagaatttcagctcttagatgcaacttaggagcttatatttccaccg
gaactaatgaggatggcagaggatccccaaaagaaagttctgatgttctatggagagagg
actacctggattgccccaggaaccctaaaagacctccgggaactgaaaatgaagcacccc
agtgctccacttgtgatgggcaacacttctcttggccttgatttgaagttcaggaatgtt
tcctatccagttatcatctctccttcaaggatcttggaattatttgtagtgactaacaca
aaagaagggttgactctgggtgctggcatcagcctggcccaggtaaaggacatcttggct
gatgtggcctctaagctccccaaggagaggacacagacttactgtgctctcttgaagcat
ctgaggaccctggctggacagcagatcaggaacatggcttccccaggtggccatattatc
agcaggctgccaacttctgatctcaaccctgttttgggtgtaggcaattgcatcctcaat
gttgcttcaacagaaggaacacagcaaattcctctaaatgatcattttcttgtgggagca
gcacatgcaagcctaaagccagagcaagtcctagtttctgttttcattcccgtctctaaa
aagtgggagtttgtatcagctttcagacaggccccacgtcagcaaaatgcccttgcgatt
tcaaacgcgggaatgcgagtccttttcaaagaagacacgaacaccattgtggacttaagc
atctcatatggaggagttggcaccactacagtcagcgtaaacaaagcctgccagaagctt
atcagaaggtgttgggatgaagggttgctgaatgaagcttgcaggctggttctagaagaa
atctcccttccagcttcagcccctggaggaatggtggaatgccaaactctcactatcagc
ttcctcttcagattttacttagatgtgttgcaacaattaaagataaggataaagatgtca
tctttgttccaggacccccatggataccctgacatctccaagaaactcttaaacattctg
gaagactttcccttgaccatgcctcacaggatgcagtcctttgagggtgtagacccccag
caatccttgcaagacccagtcaggtgccccattatgcatcagtctggcattaaacacagc
acaggggaggcagtattctgtgatgatatgcctgtcttggcagaggaactcttcctggct
gtggtcaccagcaacaggccacatgctcgaattatctcccttgatgcctctgaggccctg
gcatcacctggtgtggttgatgtgataacagctcaggatgttcctggggaaaacggcaga
gatgaagagagcctgtatgcacaggatgaggtgatttgtgtgggtcagattgtctgtgca
gtggctgcacattctgcaaagaaggctgcaaaaaaggtgaagattgtgtatcaagatgtg
gagcctgtgattgtgacagttcaggatgcactancatcattcattggacctgagaaaaac
ctagaacaaggaaatgttcaggcagcatttcaatgtgttgaccaagttcttgaaggggaa
gtacactttggaggccaggaacatttttatgtggaaattcaaagtatacgggtggtaccc
agagcagaggataaagaaatggacatatatgtgtcaagccaggatgaagcatttacacag
gaaatggcggctcacaccttaggcatcccaaagaataggatcaattgccatgtgaaaaga
gttggtggagccttcggagggaaatcaagcaagcctgggctcctggcagccatggcagcc
cagaagactggctgcccaatccgttttgttcttgagtgtggggacgacatgttgataact
ggagggcggcacccactactagggagatacaagattggctttatgaacaatgggaaaata
gaggcagcagacatcgaattttacatcaatggaggctgcacaccagatgattctgaactg
gtcatagaatacgctttgctcaaactagaaaatacttataagatctccaacctgcatgtc
tgaggccacgtctgtaaaaccaatttgccatccaacacagcattcaggggattcggcttt
ccccagagagcatttgtaacagagacctgggtgtctgctgtggcagccaaatgccacttg
ccactggagaaggttagagaattaaacatgtacaaaacaattgatagaacaattcacaag
caagagtttgacccaaagaatctgataaagtgctgggagaagtgtatggaagattcttca
tactacagcaggaaaaaagctgtggagaaatttaaccaacagagtttttggaagaagaga
ggaattgccattatccccatgaaattctcagttggatatccaaagacattttattatcag
gctgctgctctggtccatatctacacagatgggtctgtactagttgctcatggaggagtt
gaactcagacaaggtattaacaccaaaatgatacaggtggccagctgtgaattgaagata
ccagtgtcttacatccacctggatgagatgaacactgtgacaatgccaaacacaattgcc
actgcagcgtccactcgtgccaatgtcaatgggagagctgtgcagaacgcctgtcagagc
cttatgaagcacctggagcccatcatcaaccagaatcccaatgggaccggagaagtctgg
gttaatgaagcttttactcaaagcattagtctacctgccactggatattttaggggctac
aaggctgacatggactgggagaagggagaaggcaacacttttccttattttgtttttgga
gctgcctgttctgaggttgaaattgactgtctgacaggcgctcacaagaacattagaact
gatattgttatggatgcttctttcagtataaatcctgctgtggacacaggacagattgaa
ggggcatttgttcaaggtcttggactctatactccagaggagctgaaatattctcctgaa
ggagtcctatatactcgtggtccaaaccagtacaaaataccttctattactgatgtcccc
gaggaattccatgtgtccctcctaacaccaacacaaaacccaaaagccatctactcttct
aagggccttggtgaggctggaatgtttctggggtcttctgtgttctttgccattgctgat
gctgtggatgcagctcgcaaggagaggggcttgcccccagtttgggtgatgaacagccct
gccacaccggagctgattcgtatgtcccgtgtggaccagtttacagaccaggttccgtga
atggattctaaatgctgtaagccttggtccatccctgttgcctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734392
Entry
103734392         CDS       T03372                                 

Gene name
Aox1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00280  Valine, leucine and isoleucine degradation
ngi00350  Tyrosine metabolism
ngi00380  Tryptophan metabolism
ngi00750  Vitamin B6 metabolism
ngi00760  Nicotinate and nicotinamide metabolism
ngi00830  Retinol metabolism
ngi00982  Drug metabolism - cytochrome P450
ngi01100  Metabolic pathways
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103734392 (Aox1)
   00350 Tyrosine metabolism
    103734392 (Aox1)
   00380 Tryptophan metabolism
    103734392 (Aox1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    103734392 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    103734392 (Aox1)
   00830 Retinol metabolism
    103734392 (Aox1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    103734392 (Aox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734392 (Aox1)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     103734392 (Aox1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 103734392
NCBI-ProteinID: XP_008831548
LinkDB
Position
Un
AA seq 1335 aa
MDPAQELLFYVNGRKVIEKNVDPETMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYN
PSTKKIRHHPVNACLTPICSLYGTAITTVEGIGSTKTRLHPVQERIAKCHGTQCGFCTPG
MVMSMYALLRNHPEPTLDQLTDALSGNLCRCTGYRPIIDACKTFCKNSGCCQSKENGVCC
LDQGINGLPEFQEEDKTSPELFSEEEFLPLDPTQELIFPPELMMMAEKQPPKTRVFGGDR
MTWIAPVTLKDLVEAKFTYPQAPIVMGNTSVGPEVKFKGVFHPVIISPGRIEELSVVNQA
CDGITLGAGLSLDQVKDILADVVQKLPEEKTQTYCALLKHLRTLAGFQIRNMASLGGHIV
SRHLDSDLNPLLAVGNCTLNLLSKEGKRQIPLNEQFLRKCPSVDLKPQEVLVSVNIPYSK
KWEFVSAFRQAQRQQNALAIVNSGMRVLFGERDGIIKELSIFYGGVGPTTISAKDSCQKL
IGRPWNEEMLDTACRLVLDEVILPGSAPGGKVEFKRTLIISFLFKFYLEVSQILKEMDPG
HCPSLADRHKSALEDWHSRHHWRTLTHQSVDPKQLPQDPIGRPIMHLSGIKHATGEAIYC
DDMPAVDQELFLTFVTSSRAHAKILSIDLTDALSLPGVVDIVTAEHLQEANTFNTETFLA
TDKVHCVGHLICAVIADSEIQAKRAAKLVKIVYQDLKPLILTIEEAIQHKSFYESERKLE
CGNIDEAFKMVDQILEGEIHIGGQEHFYMETQSMLAVPKGEDGEMDIYVSTQFPKYIQDI
VAATLKLPANKVMCHVRRVGGAFGGKAGKTSIMAAISAFAASKHNRAVRCILERGEDMLI
TGGRHPYLGKYRAGFMNDGRILALDLEHYCNAGSTLDESLWVIEMGLLKMDNAYKFPNLR
CRGWACRTNLPSNTALRGFGFPQAGLVTEVCITEVAVKCGLSPEQVRLVNMYKQIDHTPY
KQEINAQTLSECWRECMAKSSYSVRKMAVEKFNAENSWKKRGLAMVPLKFPVGLGSAVAM
GQAAALVHIYLDGSALVTHGGIEMGQGVHTKMIQVVSRELKMPMLNVHLRGTSTETVPNT
NPSGGSVVADLNGLAVKNACQTLLRRLEPIISKNPHGTWKDWAQTAFDQRISLSAVGFFR
GYESDMDWEKGEGHAFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQ
IEGAFIQGMGLYTIEELSYSPQGVLYTRGPSQYKIPAICDIPIELHISFLPPSENSNTLY
SSKGLGESGVFLGCSVFFAIRDALSAVRQERGTSGPLKCSSPLTPERIRMACEDKFTKMI
PRDGPGSYVPWNIRV
NT seq 4008 nt   +upstreamnt  +downstreamnt
atggacccggcccaggagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gttgatcctgaaacaatgctgttaccatatctgaggaagaatctccggctcacaggaact
aagtacggctgtggcggaggaggctgtggtgcctgcacggtgatgatctcacgatataac
cccagcaccaagaaaatcagacaccatccagtcaatgcctgcctgacccctatctgctct
ctgtatggtacagccatcaccacagtagaaggcataggaagcaccaagaccagacttcat
cctgtccaggagaggattgctaagtgtcatggtacccagtgtggattctgcacccctggg
atggtgatgtccatgtatgcactgctcaggaaccacccagagcccactctggatcagtta
actgatgccctcagtgggaacctatgccgctgcactggatacaggccaataattgatgca
tgcaagactttctgtaaaaattctggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaataaatggacttccagaatttcaggaagaagataagacaagtccagaa
cttttctctgaagaggagtttcttccattggatccaacccaggagctgatatttccccca
gaactaatgatgatggctgagaaacaaccaccaaagaccagagtctttggtggtgataga
atgacatggattgccccagtgaccctgaaggaccttgtggaagctaaattcacatatccc
caggctcccattgtcatggggaacacctctgtggggcctgaagtaaaatttaaaggtgtc
ttccacccagtgatcatttctccgggtagaattgaagaactgagtgttgtaaaccaggcc
tgcgatgggataacactaggtgctggcctcagcctggatcaggtgaaagacattctggct
gatgtggtccagaagctcccagaagagaagacacagacatactgtgctcttctgaagcat
ctgagaactctggctgggttccagatcaggaacatggcttctttagggggccacatcgtg
agcagacatctggactcagatctgaatcccctcctggctgtgggtaactgtaccctcaac
ttgctgtcgaaagaagggaaacgacagattcctttaaatgagcagtttcttcgcaagtgt
cccagtgtggatcttaagcctcaggaagtcttggtctcagtgaacatcccctactccaag
aagtgggaatttgtgtcagccttccgacaagcccagcgtcaacagaatgcactagcaatt
gttaattcaggaatgagagtcctttttggagaaagagatggcatcattaaggagttatcc
attttttatggaggtgttggtccaaccaccatcagtgctaaggattcctgccagaaactc
atcggaaggccttggaatgaagagatgctggatacagcatgcaggctggttttggatgaa
gtcatccttccaggctcagctccaggtgggaaggtggaattcaagaggaccctcatcatc
agcttcctcttcaagttctacctggaagtgtcacagattttgaaggagatggacccaggt
cactgtcctagcctggcagacagacataagagtgctttagaagattggcattctagacat
cactggagaacgctaacccaccagagtgtagacccaaagcagctgcctcaagacccaatt
ggccgtcccatcatgcacctgtctggtattaaacatgccacaggagaagccatctattgt
gatgacatgcctgcagtagaccaggaactttttctgacttttgtaactagttcaagagct
catgctaagattctgtccattgatctgacagatgctctcagtctgccaggtgtggtggac
attgtgactgctgaacatcttcaggaagcaaacactttcaacacagagacattcctggct
acagataaggtccattgtgtaggtcatcttatctgcgcagtgattgcagattctgagatt
caggccaaacgagctgcaaagctagtgaagattgtctaccaagacctgaagccgctgatc
ctaacaattgaggaggctatacaacacaagtccttctacgagtctgaaaggaagctggag
tgtggaaatattgatgaagcatttaaaatggttgatcagattcttgaaggtgaaatacat
ataggaggtcaagaacatttttatatggaaacccaaagcatgcttgctgttcccaaagga
gaggacggagaaatggatatctatgtgtccacacagtttcccaagtatatacaggatata
gttgccgcaaccttgaagctcccagctaacaaggtcatgtgtcacgtgaggcgtgttggc
ggtgcatttggggggaaggcaggcaaaaccagcatcatggcagccatcagcgcttttgct
gccagcaaacataatcgtgcagtccgttgcattctggaaagaggagaagacatgttaatc
acaggaggccgccatccttaccttggaaagtacagagctggattcatgaacgatggcaga
atcttggccctggacctggagcattattgtaatgcaggtagcaccctggatgaatcatta
tgggtaatagaaatgggacttctgaagatggacaatgcttacaagtttccgaacctgcgc
tgccggggctgggcctgcagaactaatcttccatccaacacggcacttcgtgggtttggc
tttcctcaggcagggctggtcaccgaggtctgcatcacagaggtggcggtcaagtgtggc
ctgtccccagagcaggttcgactggtaaatatgtacaagcaaattgatcatactccctac
aagcaagagattaatgcccagaccctctccgagtgttggagagaatgtatggccaagtct
tcctactctgttaggaaaatggcagtggaaaaattcaacgcagagaattcctggaagaag
agagggctagccatggtacctctgaagtttcctgtgggtcttggctcagcagtagccatg
ggtcaggcagctgccctggttcacatttatcttgatggctctgcactggtcactcatggt
gggattgagatggggcaaggtgtccacactaaaatgattcaggtggtcagccgtgaatta
aagatgccaatgctaaatgtccacctgcgtgggacaagcacagaaaccgtccctaacaca
aatccgtccggagggtccgtggtggcagatctcaatgggttggcagtaaagaatgcttgt
caaactcttctaagacgccttgaacccatcatcagcaagaatcctcatggaacttggaag
gactgggcacagactgcttttgaccaaagaatcagtctttcagctgttggattcttcagg
ggttacgagtcagacatggactgggagaaaggcgaaggccatgccttcgaatactttgta
tatggagctgcctgttcagaggttgaaatagactgcctgacaggggaccacaagaacatc
agaacagacatcgtgatggatgttggccacagcataaatccagcccttgacataggccag
attgaaggagcgtttattcaaggaatggggctttatacaatagaggaactgagttactct
cctcaaggtgttttgtatacacgtggtccgagccagtataaaattcctgccatctgtgac
atccccattgagctgcacatttcttttttgcccccatctgaaaactcaaacaccctgtat
tcgtctaagggtctgggagagtctggggtgttcctggggtgttcagtgttttttgccatc
cgtgatgcattgagtgcagtgcgacaggagagaggcacctctgggccactgaagtgcagt
agtccactgactccagagaggatcagaatggcctgtgaggacaagttcacaaagatgatt
ccaagagatggacctgggtcctatgttccctggaatatacgtgtctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734495
Entry
103734495         CDS       T03372                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00280  Valine, leucine and isoleucine degradation
ngi00350  Tyrosine metabolism
ngi00380  Tryptophan metabolism
ngi00750  Vitamin B6 metabolism
ngi00760  Nicotinate and nicotinamide metabolism
ngi00830  Retinol metabolism
ngi00982  Drug metabolism - cytochrome P450
ngi01100  Metabolic pathways
ngi04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103734495
   00350 Tyrosine metabolism
    103734495
   00380 Tryptophan metabolism
    103734495
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    103734495
   00760 Nicotinate and nicotinamide metabolism
    103734495
   00830 Retinol metabolism
    103734495
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    103734495
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103734495
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     103734495
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 103734495
NCBI-ProteinID: XP_008831690
LinkDB
Position
Un
AA seq 1366 aa
MPGPSRSSDELVFFVNGRKVTERNVDPEETLLAFLRKNLRLTGAKYACGTGGCGACTVML
SKHDLVSKKIRHFSVTACLVPLCSLHGAAVTTVEGVGSIKTRIHPVQERIAKIHGTQCGF
CTPGMVMSMYTLLRNHPQPLEEQLMEALGGNLCRCTGYRPILESGRTFCMESVGCQQKGT
GKCCLDQRENDSLGGRSDICTELFAKEEFQPLDPTQELIFPPELLRMAENPEKQTLTFHG
ERVTWISPGILQNLLALKAKHPKAPLILGNTSLGPAMKTQGHFYPILLSPARIPELSMVT
KTSDGLTIGAGCSLAQVKDILAESISELPEEKTETYRALLKHLRSLAGQQIQNMASLGGH
IISRHCYSDLNPILSVGNTALNLLSEDDMRQIPLDEHFLAGLASSDLKPEEILGSVHIPH
SQKWEFVSAFRQAQCHQNALPDVSAGMRVLFKKGTDTIEELSIAYGGVGPATISAHIACQ
QLLGRRWNELMLDEACRWLLDEVSLSGSAPGGKVEFKRTLLVSFLFKFYLEVLQKLKAQV
KLPLVPTDNRSYPEIADRFLSALEDFQVTLPQGLQMYQRVDSHQPPRDAVGRPIMHLSGL
KHATGEAIFCDDIPRVDKELFMALVTSTRAHAKIISIDSSEVLELPGVVDVITAEDIQGT
NNTEDEKLLALDEVLCVGQVICAVVAETDVQAKRATGKIKITYEDLKPVIFTIEDAVKHN
SFLCPEKKLEQGNIEEAFENVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVS
TQDPAHVQKMVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFAAIAAVGAVKTGHPIRL
VLDREDDMLITGGRHPLFGKYKVGFMNNGRIKALDINCYINGGCTLDDSELVIEFLILKL
ENAYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLPPEMIREKN
MYKTVDKTIYKQAFSPETLIRCWNECLDKSSFQSRRMQVEEFNKQNYWKKRGIAIIPMKF
SVGFATTSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASHELKIPMSYMHICE
TSTATVPNTIATAASIGADVNGRAVQNACQILLKRLEPIIKKNPEGTWEDWIKAAFEQRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEIEIDCLTGAHKKIRTDIVMDACCS
LNPAIDIGQIEGAFVQGMGLYTTEELQYSPEGVLYSRSPEEYKIPGITDVPEQFNVSLLP
SSQTPLTIYSSKGLGESGMFLGSSVFFAIADAVAAARRERNLAEDFMVKSPATPERVRMA
CADRFTDMCALCHLLTYPNASSHPAEESSFAMLYSKKGNYPIHSCA
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgcctggcccatcacggagctcagatgagctggtgttcttcgtgaacgggaggaaggta
acagagaggaatgtggacccagaagagactctgctggccttcctgcgaaagaacttacgc
ctcacaggagccaagtatgcctgtggaacaggaggctgtggggcctgcactgtgatgctg
tccaagcacgacctggtgtccaagaagataagacacttctctgtcactgcatgtctggtg
cccctctgctctctgcatggggccgctgtcaccaccgtggaaggtgtaggaagcatcaaa
accaggattcatccagtgcaggagaggattgccaagatccacggcacccagtgtggattc
tgcacccctgggatggtgatgtccatgtacacactgctcaggaaccatccacagcccttg
gaggagcaactcatggaagccctggggggtaatctatgccgttgcactgggtatcggccg
attctggagagtggcaggaccttctgcatggagtccgttggctgtcaacagaaaggaaca
ggaaaatgctgcttggatcaaagagaaaatgattctcttggaggcagaagtgatatttgc
acagagctatttgcaaaagaggagttccagcccttggacccgacccaggagctcatattt
cccccagaactcttgaggatggctgagaacccagaaaaacaaaccctgacctttcatgga
gagagagttacctggatctcccctggaatcctccagaatctcttggcgctgaaagcaaag
caccccaaagcccctctcatcctgggcaacacgtctctgggaccagctatgaaaactcaa
ggacacttttacccaattctcctctctcctgctagaatccctgagctgagcatggtgacc
aaaaccagtgatggactgaccattggcgccggctgcagcctggctcaggtgaaggacatc
ctggctgagagcatctctgagctcccagaggagaaaactgagacctacagagccctcctg
aagcacctacggagcctggcaggccagcagatccagaacatggcatccttaggtggacat
attataagccggcattgctattcagacctgaatcctattctttctgtgggcaacactgcc
ctcaatctgttatcagaagacgatatgaggcagattcctctagatgaacattttctcgct
gggttggcaagttcagacctgaagccagaagagattttgggatctgtgcacatccctcac
tctcaaaagtgggagtttgtgtctgccttccgacaggcccagtgccatcaaaatgccttg
cctgatgtgagtgctggcatgagggtactgttcaaaaaaggcacagacacgattgaggaa
ctgagcatcgcctatggaggggtggggcctgctaccatcagtgcacacatagcctgccag
cagctcctcggcagacgctggaatgagctcatgctggacgaggcttgtaggtggcttcta
gatgaagtctccctctccggctcagctccagggggcaaggtggagttcaagaggactcta
ctagtcagcttcctcttcaagttctacctggaggttttgcagaaattgaaagcacaagta
aaactgcccttggtgcctaccgacaaccggagttatccagagattgcagaccggttccta
agtgctctggaagatttccaggtcacattaccccagggactccaaatgtaccagagagtg
gattctcaccagcctccccgagatgcagttggacgtcccatcatgcacctatcaggtctt
aaacacgctacaggggaagccatattttgtgatgacattcccagggtggataaagaactt
tttatggctttggtgaccagcaccagggctcatgcaaaaatcatctcaattgattcctct
gaggtccttgaactacctggagtggttgatgtgataacagctgaagatattcaaggcacc
aataacactgaggatgagaaattgttggctttagatgaggtgctttgtgtaggccaggtc
atctgtgctgtggttgcagaaactgatgtccaggcaaaacgagcaactggaaaaataaaa
atcacctatgaggatctgaagcctgtaatttttaccattgaggatgctgttaaacataat
tcattcctgtgtcctgaaaaaaagcttgagcaaggaaacattgaggaggcatttgaaaat
gtggatcagattgttgaaggagaggtccatgttggaggacaggaacatttttacatggaa
acacaaagagtgctcgttattccaaagacagaggacaaagaactggacatctatgtttcc
acacaggatccagcccacgtgcagaaaatggtgtcttctaccttaaacatccctatcaac
aggatcacctgtcacgtgaaacgagtgggtggaggttttggaggaaaggtgggaaggcca
gctgtgtttgcagcaattgcagctgtgggggctgtcaaaactggccatcccatccgtctt
gttctggatcgtgaagatgatatgctaataactggaggaaggcatccattatttggaaaa
tataaagtgggattcatgaacaacgggagaatcaaagctctagacatcaattgctacatc
aatggaggatgcaccctggatgactcagagctggtaatagaatttcttatactaaaactg
gaaaatgcgtataaaatccgcaacctcagattccggggccgtgcatgcatgacaaattta
ccgtccaatacagctttccgtggctttggcttcccacaaggaaccctggtaacagaatcc
tgcatcacagctgtggcagccaaatgtgggcttccaccagaaatgattagggagaaaaac
atgtacaaaacagttgataaaaccatctacaaacaagctttcagtcctgagaccctgata
agatgttggaacgaatgtctggacaagtcttcctttcagagcagaaggatgcaagtggaa
gagttcaataagcagaactactggaagaagagaggcattgctattattcccatgaagttt
tcagtcggctttgctacgacaagctatcatcaggcagctgcccttgtccacatctacaca
gacgggtctgtgttggtcacacacggaggcaatgaactgggacaaggtatccataccaaa
atgttacaggtagccagccatgaattaaaaatacccatgtcttacatgcacatctgtgaa
acaagcaccgcaacagttcctaatacaattgctacagcagcatccatcggagcagatgtc
aacggcagagctgtgcagaatgcttgccagatccttctgaaacgtcttgaacccatcatt
aagaaaaatccagaaggcacatgggaagactggataaaagcagcatttgaacaaagaatc
agtctttcagccactggatacttcaggggctacaaggccttcatggactgggaaaagggg
gagggagatccatttccatactatgtctacggagctgcctgttctgagattgaaattgat
tgtctgacaggtgctcacaagaaaatcagaacagacattgtcatggatgcatgttgcagc
ctaaatccagccattgatattggacagatagaaggtgcatttgttcaaggaatgggcctc
tacaccactgaagagctacagtattctccagaaggtgtcttatactctcggagcccagag
gagtataaaatcccaggcatcactgatgtccctgagcagtttaacgtgtccttactacca
tcatctcagaccccactaaccatctactcatccaagggccttggggagtcggggatgttc
ctagggtcatctgtgttctttgccatcgctgatgcagtagcagcagcacgcagagaaaga
aacttggccgaggacttcatggtgaagagtccagcaacaccagagcgggtgcggatggcc
tgtgctgaccgctttacagacatgtgtgctctatgtcaccttctcacctatccaaatgcc
tcatctcaccctgctgaggagtcctcttttgccatgctctattccaaaaaaggcaactac
cccattcacagctgcgcttga

DBGET integrated database retrieval system