KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734391
Entry
103734391         CDS       T03372                                 

Gene name
Kit
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04916  Melanogenesis
ngi05200  Pathways in cancer
ngi05221  Acute myeloid leukemia
ngi05224  Breast cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734391 (Kit)
   04014 Ras signaling pathway
    103734391 (Kit)
   04015 Rap1 signaling pathway
    103734391 (Kit)
   04072 Phospholipase D signaling pathway
    103734391 (Kit)
   04151 PI3K-Akt signaling pathway
    103734391 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103734391 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    103734391 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734391 (Kit)
   05230 Central carbon metabolism in cancer
    103734391 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103734391 (Kit)
   05224 Breast cancer
    103734391 (Kit)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103734391 (Kit)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103734391 (Kit)
CD molecules [BR:ngi04090]
 Proteins
  103734391 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 V-set Pkinase_fungal APH DUF2062
Other DBs
NCBI-GeneID: 103734391
NCBI-ProteinID: XP_008831541
LinkDB
Position
Un
AA seq 977 aa
MRGASGAWDLLGVLFVLLCGHTGSSQPSVSPGEPSPPSIQPAQSELIVGTGDTIRLICED
PAFDKWTFETLGHVSESSKHNEWIRGKAEAAHTGKYTCTNSGGLQSSIYVFVRDPAVLFL
VGLPLYGKEDNDTLVRCPLTDPEVDNYSLKECDGKSLPEDLMFVPDPKAGITIRNVKRAY
HRLCVRCAAQRDKEWVLSDRFVLKVRAAIKAIPLVSVSKTSYLLREGDKFMVTCTIKDVS
TSVGSMWIKESAQIKAQVKRNSWHRGDFDYERQETLTISSARVNDSGVFMCYANNTFGSA
NVTTTLKVVDKGFINILSTKNTTVFVNDGENVDLVVEYEAYPKPEHQQWIYMNRTSTNKW
DDYPKSENTSNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASVTFSVYVNTKPEILTYD
RLMNGMLQCVAAGFPEPTIDWYFCTGAEQRCTGPIPPVDVQIQNTSTPPFGKLVVQSSID
SSAFLHNGTVECKAYNDVGKISAFFNFAFKGNNKEQIQAHTLFTPLLIGFVITAGMMGII
VMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGA
FGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGA
CTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEDQAEAALYKNLLHSKESSCSDSTN
EYMDMKPGVSYVVPTKTEKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEM
YDIMKTCWDADPLKRPTFKQVVQLIEKQISDSTSHTYSNLTNCNPSLENPVVDHSVRVNS
VGSSASSTQPLLVHEDA
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgagaggcgcttcaggcgcctgggatctgctcggcgtcctgttcgtcctgctgtgcggc
cacacaggctcttcgcagccatctgtgagtccaggagagccgtctccaccatccatccag
ccagcacagtcggagttaatagtcggcacaggcgacacaatcaggctgatatgtgaggat
cctgccttcgataagtggactttcgagaccctgggtcatgtgagtgagagcagtaagcac
aatgaatggattcgaggaaaggctgaagctgctcacacaggcaaatacacatgcaccaac
agcggcggcctccaaagttccatttacgtctttgttagagatccggctgtgctttttctt
gtcggccttcccctgtacgggaaagaagacaacgacacgctggtccgctgtcctctgacg
gacccagaggttgacaactattccctcaaggaatgtgatgggaaatctctccctgaggac
ctgatgtttgtcccagatcccaaggctggcatcacaatcagaaacgtgaagcgcgcctac
caccgactctgtgtccgatgtgctgcccagcgggacaaggagtgggtactgtctgacaga
ttcgtcctgaaagtgagggcagccatcaaagctatcccacttgtctctgtgtccaaaaca
agctatcttcttagggaaggagacaaatttatggtaacgtgtacaataaaagatgtgtct
acttctgtgggctcgatgtggataaaggaaagtgctcagattaaagctcaggtaaaacgt
aatagctggcatcggggtgacttcgattatgaacgccaggaaaccttgactatcagctca
gcaagagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagca
aatgtcacaacaaccttgaaagtagtagataaaggattcattaatatcctctccacaaag
aacactacggtatttgtgaatgatggagaaaatgtagatttggttgttgaatatgaggca
taccccaaacctgaacaccagcagtggatatacatgaacaggacctccactaacaagtgg
gatgattatcccaagtctgagaacacaagtaatatcagatatgtgagcgagcttcatcta
accagattaaaaggcaccgaaggaggcacttacacgtttctggtgtccaactctgatgtc
aatgcttccgtgacatttagtgtttatgtgaacacaaaaccagaaatcctgacatacgac
aggctcatgaatggcatgcttcagtgtgtggcagcgggattcccagaacccacaatagat
tggtatttttgtacaggagcagagcaaaggtgtactggtcccatcccacctgtggatgta
cagatccagaacacatctacaccaccatttggaaaactggtggttcagagctctatagac
tccagtgctttcctgcacaatggcacagtggagtgtaaggcttacaacgatgtgggcaag
atctctgccttctttaactttgcatttaaaggtaacaacaaagagcaaatccaggcgcac
accctgttcacaccgctgctcatcggctttgtgatcacagctggcatgatgggtatcatt
gtgatggttctcacttacaaatatttacagaaacccatgtatgaagtacaatggaaggtt
gtcgaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgat
cacaaatgggagtttcccagaaacaggctgagttttgggaagactttgggtgccggtgcc
tttggcaaggttgttgaggccactgcttatggcttaattaagtcagatgctgccatgacg
gttgctgtaaagatgctcaaaccaagtgctcatttaacagagagggaggccctcatgtct
gagctgaaggtcctgagctacctaggcaatcatatgaatattgtgaatcttctcggagca
tgcaccgttggagggcccaccctggtcattacagaatattgttgctatggtgatcttttg
aattttttgagaagaaaacgtgattcatttattttctcaaagcaggaagatcaggcagaa
gcagcactttacaagaaccttctgcattcaaaggagtcttcctgcagtgacagtaccaac
gagtacatggacatgaagcctggagtgtcttacgttgtaccaactaagacagaaaaacgg
agatctgcgagaataggctcgtacatagaaagagatgtgactcccgccatcatggaggat
gacgagctggctttggacctggaagacttgctgagcttttcctaccaggtggccaagggc
atggcttttctcgcctccaagaactgtattcacagagacttggcagccagaaacatcctc
cttactcatggtcggatcacaaagatttgtgatttcggtctagccagagacatcaagaat
gattccaattatgtggttaagggaaacgcccgactgcctgtgaagtggatggcaccagag
agcatcttcaactgcgtgtacacatttgaaagtgatgtctggtcctatgggatttttctg
tgggagctattctccttaggaagcagcccttaccctgggatgccagtcgattccaagttc
tacaagatgatcaaggaaggcttccggatgctcagccctgagcatgcacctgctgaaatg
tatgacataatgaagacttgctgggatgctgatcccctgaaaaggccgacgttcaagcag
gtggtccagctcattgagaagcagatttcagatagcaccagccatacttactccaactta
acaaactgcaaccccagcctggagaacccggtggtggaccattctgtgcgggtcaattcg
gttggcagcagcgcctcttccacccagcctctgcttgtgcacgaagatgcctga

DBGET integrated database retrieval system