KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734393
Entry
103734393         CDS       T03372                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734393 (Pdgfra)
   04014 Ras signaling pathway
    103734393 (Pdgfra)
   04015 Rap1 signaling pathway
    103734393 (Pdgfra)
   04630 JAK-STAT signaling pathway
    103734393 (Pdgfra)
   04020 Calcium signaling pathway
    103734393 (Pdgfra)
   04072 Phospholipase D signaling pathway
    103734393 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    103734393 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103734393 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103734393 (Pdgfra)
   04540 Gap junction
    103734393 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103734393 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734393 (Pdgfra)
   05206 MicroRNAs in cancer
    103734393 (Pdgfra)
   05230 Central carbon metabolism in cancer
    103734393 (Pdgfra)
   05231 Choline metabolism in cancer
    103734393 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    103734393 (Pdgfra)
   05218 Melanoma
    103734393 (Pdgfra)
   05215 Prostate cancer
    103734393 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103734393 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103734393 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103734393 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103734393 (Pdgfra)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103734393 (Pdgfra)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103734393 (Pdgfra)
CD molecules [BR:ngi04090]
 Proteins
  103734393 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE DUF3912 Kinase-like
Other DBs
NCBI-GeneID: 103734393
NCBI-ProteinID: XP_008831544
LinkDB
Position
Un
AA seq 1088 aa
MGTFHWAFLVFGCLLTGPSLILCQLLLPSILPNENEKVVQLNSSFSLRCFGESEVSWQHP
MSEEEDPDVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETHVTLYNEGRLVFASYDSKQGFNG
TFSVGPYICEATVQGKTFQTNAFNVYALKATSELNLEMEAHQTVYKSGETIMVTCAVFNN
EVVDLQWTYPGEVKNKGITMLEEIKVPSIKLVYTLTVPKATVKDSGDYECAARQATKEVK
EMKTVTISVHEKGFVEIKPTFGQLEAVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVKKIQETRYQSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCTAAGTPLPDIEWMICKDIKKCNNDTSWTTLANNISNIPTELHRRG
RSTVEGRVTFAKVEETIAVRCVAKNHLGNGNRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEDDKLKDWEGGVDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgggaactttccactgggccttcctggtcttcggctgtctcctcacagggccgagcctc
atcctctgccagctcttattaccctctatcctcccaaatgagaacgagaaggttgtgcag
ctgaattcatccttttctttgagatgctttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccgacgtggaaatcagaagtgaggagaacaacagcggcctc
tttgtgacagtgctggaagtggtcaacgcctcggcagcccacaccggatggtacacttgc
tattacaaccacactcagacagaagaaagtgagatagagggcaggcacatttacatctat
gtgccagacccagacatggcctttgtgcctctaggaatgacagattctttagtcattgtg
gaagaagacgattctgccatcataccttgtcgcaccacagatccagagactcatgtaact
ctgtacaatgagggtaggctggtgtttgcctcttacgacagcaagcagggcttcaatggg
accttcagtgtggggccctacatctgtgaggccaccgtccaagggaagacattccagacc
aatgcatttaatgtttatgctttgaaagcaacatcggagctgaatctagagatggaagct
catcaaactgtatataaatcaggagaaacgatcatggtgacctgtgctgtctttaacaat
gaggtggttgatcttcagtggacttaccctggagaagtgaaaaacaaaggcatcaccatg
ctggaagaaattaaggtcccatccatcaaattggtgtacactttgacagtccccaaggcc
acggtgaaagacagtggagattatgagtgtgctgcccgccaggctactaaggaggtcaaa
gaaatgaagacagtcaccatttctgtccatgagaaaggttttgttgagatcaagcccacc
tttggccagctggaagccgtcaacctgcatcaagtcagggagttcgtggtggaggtacaa
gcctaccctactcccaggatatcatggctgaaggacaacttgactctgattgagaatctc
actgagatcaccactgatgtgaaaaagattcaggaaacaaggtatcaaagcaaattaaag
ctgattcgggctaaggaggaagacagtggccattataccatcgtagttcaaaatgaagat
gatgtgaagagctacacttttgagctgtcaactctagttcccgcatccattctggagctg
gttgacgaccatcacggctctggtgggggacagactgtgaggtgcacagctgcaggcaca
cctcttccggacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacact
tcatggacaactttggccaacaatatctcaaatatccccactgagctccaccgccgaggc
aggagtactgtggagggccgagtgacattcgccaaagtcgaggagaccattgcagttcga
tgcgtggcaaagaatcaccttgggaatgggaaccgagaactgaagctggtggctcccacc
ctgcgttctgagcttacagtagcagctgcagtcttggtgctgttggtgattgtgataatc
tcactcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttattgagtcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctt
ccctatgactccagatgggagttcccaagagatggactagtgcttggtcgaatcctggga
tctggtgcatttgggaaagtagttgaaggaacagcctatggattaagccggtcccagcct
gttatgaaggtagcagtgaagatgctcaaacccacagccagatccagtgaaaagcaagct
ctcatgtctgagctgaagataatgactcacttgggaccacatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaacagagatagcttcctgagccgacacccagagaag
ccaaagaaagagctggacatctttggattgaaccctgctgatgaaagtacaaggagttat
gtgattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatattcagacatccaaagatcg
ctgtatgatcgtccagcctcctataagaagaaatctatgctagactcagaagtcaaaaat
ctcctttcagatgactcggaaggccttactttgctggatttgttgagcttcacctatcaa
gttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacttggctgcc
cgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggccaga
gatattatgcatgattcaaactacgtgtcaaaaggcagcaccttcctgcctgtgaagtgg
atggcccctgagagcatctttgacaacctatacaccaccctgagtgatgtctggtcttat
ggcattctcctttgggagatcttttctcttggtggcacaccctaccctggcatgatggta
gattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccatgcc
accagtgaagtctatgagattatggtacagtgctggaacagtgagccagagaagagaccc
tccttctaccatctgagtgagatagtggagaatctgttgcctggacaatataaaaagagt
tatgaaaagattcacctggacttcctgaaaagtgatcaccctgctgtggcacgcatgcgt
gtggactccgacaatgcgtacattggtgtcacctacaaaaatgaagacgacaagctgaag
gactgggagggtggcgtggatgagcagagactgagtgctgacagtggctacatcatccct
ctgccagatattgaccctgttccagaggaggaagacctgggcaagagaaacagacacagc
tcccagacctctgaagagagtgccattgagacaggttccagcagttccaccttcatcaag
agagaggacgagaccattgaggacattgacatgatggatgacattggcatagactcctca
gacctggtggaggacagcttcctgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737431
Entry
103737431         CDS       T03372                                 

Gene name
Met
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04360  Axon guidance
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi05100  Bacterial invasion of epithelial cells
ngi05144  Malaria
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05211  Renal cell carcinoma
ngi05218  Melanoma
ngi05223  Non-small cell lung cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103737431 (Met)
   04014 Ras signaling pathway
    103737431 (Met)
   04015 Rap1 signaling pathway
    103737431 (Met)
   04020 Calcium signaling pathway
    103737431 (Met)
   04151 PI3K-Akt signaling pathway
    103737431 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103737431 (Met)
   04520 Adherens junction
    103737431 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103737431 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737431 (Met)
   05202 Transcriptional misregulation in cancer
    103737431 (Met)
   05206 MicroRNAs in cancer
    103737431 (Met)
   05205 Proteoglycans in cancer
    103737431 (Met)
   05230 Central carbon metabolism in cancer
    103737431 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103737431 (Met)
   05226 Gastric cancer
    103737431 (Met)
   05218 Melanoma
    103737431 (Met)
   05211 Renal cell carcinoma
    103737431 (Met)
   05223 Non-small cell lung cancer
    103737431 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103737431 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    103737431 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103737431 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103737431 (Met)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103737431 (Met)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  MET family
   103737431 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like Ninjurin
Other DBs
NCBI-GeneID: 103737431
NCBI-ProteinID: XP_017654662
LinkDB
Position
Un
AA seq 1382 aa
MKAPTVLAPGILVLLLTLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIRNLILHRH
HIYLGATNYIYVLNDKDLQKVAEYKTGPVLEHPDCFPCQDCNSKVNLSGGIWKDNINMAL
IIDTYYDDQLISCGSVNRGTCQRHVLPRDNPADIQSEVHCMFSPQVDEESGQCPDCVVSA
LGAKVLLSEKERFINFFVGNTINSSYLPDHSLHSISVRRLKETQHGFKFLTDQSYIDVLP
EFQDSYPIKYIHAFESNRFIYFLTVQKETLNAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTRKEVFNILQAAYVSKPGINLAKQIGASPNDDILYAVFAQSKPDSAEPLNR
SAVCAFPIKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSNEYRTE
FTTALQRVDLFMGQFNHVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRTVSFTPHVNF
LLDSHPVSPEVIVEHPLNQNGYTLVATGKKLTKIPLNGLGCGHFQSCSQCLSAPSFVQCG
WCHNRCVQSDECPNGTWTQEICLPTIYKVLPTSAPLEGGTMLTICGWDFGFKKNNKFDLR
KTKVLLSNESCTLSLSESTANTLKCTVGPTMSEHFNMSIIISNSRGTTQYSTFSYVDPVI
TSISPSYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISAE
FPVKLKIDLANRETSSFSYREDPVVYEIHPTKSFVSGGSTITGIGKNLNSVGIPKLVINV
HEAGRNYTVACQHRSNSEIICCTTPSLQQLNLQLPLRTKAFFMLDGIFSKHFDLIYVHNP
VFKPFERPVVISMGNENVLEIKGNDIDPEAVKGEVLTVGNKSCENIHSHSEAVLCTVPSD
LLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLVIGVVSTSMILLLLLGLFLWLKKRK
QIKDLGDERVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLADLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAEMRPSFSELVSKISAIFSTFIGEHYVHVNATYVNIKCVAPYPSLLSSQDNIDGEV
NT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccccactgtgctggcacctggcatccttgtgctgctgcttaccttggtgcag
aggagccatggggagtgcaaggaggccctggtgaagtccgagatgaacgtgaacatgaag
tatcaactccccaacttcaccgcagaaacccccatccggaatctcatcctgcacagacat
catatttacctcggagccacgaactacatttatgttttaaatgacaaagaccttcagaag
gtggcagagtacaagactgggcctgtgttggaacacccagattgttttccatgtcaggac
tgcaacagcaaagtcaatttgtcaggaggcatttggaaggataacatcaacatggccttg
attattgacacatactatgatgaccagctcattagctgtggcagtgtcaacagaggaacc
tgccagcgccatgttcttccacgtgacaaccctgctgacatacagtctgaggtccattgc
atgttctccccccaggtggacgaagagtcaggccagtgtcctgactgtgtggtaagtgcc
ctcggagccaaagtcctcctgtctgaaaaagaacggttcatcaatttctttgtggggaac
accatcaattcttcctaccttccagatcattcattgcattcaatatcagtgagaaggctg
aaggaaacccaacatggctttaagtttttgacagatcaatcctatattgatgtcttacct
gagttccaagattcttaccccataaagtacatacatgcctttgaaagcaaccgttttatt
tactttctgactgtccaaaaggaaaccctcaatgctcagacttttcacacaagaataatc
aggttctgttctgtagactctgggttgcattcctacatggaaatgcctctggagtgtatt
ctcacagaaaagagaagaaagagatccacaaggaaggaagtgtttaatatcctccaagct
gcctatgtcagtaagcctgggatcaaccttgctaagcagataggagccagcccaaatgat
gacattctctatgcagtgtttgcccaaagcaagccagattcagctgaacccctgaatcga
tcggcagtgtgtgcattccctatcaagtatgtcaacgaattcttcaacaagattgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccccaaccatgagcactgtttcaac
aggaccctgctgagaaattcctcaggctgtgaagtgcgcagcaatgaatatcgaacagaa
tttaccactgctttgcagcgtgttgacttattcatgggccaattcaaccacgtgctctta
acatctatatctaccttcattaaaggtgacctcaccattgcaaatctggggacgtcagaa
ggtagattcatgcaggttgtggtttctcgaacggtgtcattcacccctcatgtaaacttt
ctcctggattcccaccctgtgtctccagaagtgattgttgaacaccctttaaaccaaaat
ggctatacactggttgccacagggaagaagctcaccaagatcccattgaatggcctgggc
tgtggacatttccagtcctgcagtcagtgtctctctgccccttcctttgtgcagtgtggc
tggtgccacaatcgatgtgtgcaatcagatgaatgccccaacgggacatggactcaagag
atctgtctacctacaatctataaggttttacccactagtgcaccccttgaaggagggacc
atgctgaccatatgtggctgggactttggattcaagaagaataataaatttgacttaagg
aagaccaaagttcttctcagcaatgagagctgcaccttgtccttaagtgagagcacggcc
aatacgttgaaatgcacagttggtcctacgatgagtgagcacttcaatatgtccataatt
atctcaaacagccgaggaacaacacaatacagtacattttcctacgtagatcctgtaata
acaagtatttctccaagttacggtcctcaggctggaggcactttactcactctgaccgga
aagtacctaaacagtgggaattctagacacatttcgattggtgggaaaacatgtacttta
aaaagtgtgtcaaacagtattcttgaatgttataccccagctcaaaccatctctgctgag
tttcctgttaagttgaaaattgacctagctaaccgagaaacaagcagcttcagttaccgg
gaagaccccgttgtctatgaaatccaccccaccaaatcttttgttagtggtggaagcaca
ataacaggtattgggaaaaacctgaattcagtcggcatcccgaagctggtaataaatgtg
catgaagcaggaaggaactacacagtggcgtgtcagcatcgctctaattcagagatcatc
tgctgcaccactccttcactgcaacagctgaacctgcaactccccctgaggaccaaagcc
tttttcatgttagacgggatcttttccaaacactttgatctcatttatgtccataatcct
gtgtttaagccttttgaaaggccggtggtgatctcaatgggcaatgaaaatgtactcgaa
attaagggaaatgatattgaccccgaagctgttaaaggtgaagtgttaacagttggaaat
aagagctgtgagaatatacactcccattctgaagctgttttatgtacggtccccagtgac
ctgctgaaattgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgtc
cttggaaaagtgatagttcaaccagatcagaatttcacaggattggtaattggtgtggtc
tcaacatcaatgatacttttgttattactcgggcttttcctgtggctaaaaaagagaaag
caaattaaagatctgggtgatgaacgggtccgctatgatgcaagagtacacactcctcat
ttggataggcttgtcagtgcccgaagtgtaagtccaactacagaaatggtttcaaatgaa
tctgtagactaccgagctacttttccagaagaccagtttcctaactcttctcagaatgga
tcatgcagacaagtgcaatatcctctggcagacctgtcccccatcctaactagtggggac
tcggatatatccagcccattactgcaaaatactgtccacattgacctcagtgctctaaat
ccagagctggtccaagcagtccagcatgtagtgattgggcccagtagcctgattgtgcat
ttcaatgaagtcataggaagagggcattttggctgtgtctatcatgggactttgttggac
aatgatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacatcgga
gaagtttcccagtttctgactgagggaattatcatgaaagatttcagtcatcccaatgtt
ctctcactcttgggaatctgccttcggagtgaagggtccccactggtggttctgccatac
atgaagcatggagatcttcgaaatttcattagaaatgagactcataacccgactgtaaaa
gatcttataggatttggtcttcaagtagccaagggcatgaaatatcttgcaagcaagaag
tttgtccacagagacttagctgcaagaaactgtatgttggatgaaaagttcactgtcaag
gttgctgactttggtcttgccagggacatgtatgataaagaatactacagtgtacacaac
aaaacaggtgcaaaactgcccgtgaagtggatggctttagaaagtctgcaaactcagaag
tttaccaccaaatcagatgtgtggtccttcggcgtgcttctctgggagctgatgacaaga
ggagcccctccttatcctgacgtcaacacatttgatatcaccgtctacttgttgcaaggc
agacgactattacaaccagaatactgcccagaccccttgtatgaagtgatgctaaaatgc
tggcaccccaaagctgaaatgcgcccatcgttttctgagctggtctccaagatatcagca
atcttctccactttcattggggagcactacgtccatgtgaacgctacttatgtgaatata
aaatgtgttgctccatatccttctttgttgtcatcacaagacaacattgacggcgaggtg
aacacatga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745770
Entry
103745770         CDS       T03372                                 

Gene name
Fgfr1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04520  Adherens junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04714  Thermogenesis
ngi04810  Regulation of actin cytoskeleton
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103745770 (Fgfr1)
   04014 Ras signaling pathway
    103745770 (Fgfr1)
   04015 Rap1 signaling pathway
    103745770 (Fgfr1)
   04020 Calcium signaling pathway
    103745770 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    103745770 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103745770 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103745770 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103745770 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103745770 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103745770 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103745770 (Fgfr1)
   05205 Proteoglycans in cancer
    103745770 (Fgfr1)
   05230 Central carbon metabolism in cancer
    103745770 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    103745770 (Fgfr1)
   05215 Prostate cancer
    103745770 (Fgfr1)
   05224 Breast cancer
    103745770 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103745770 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103745770 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103745770 (Fgfr1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103745770 (Fgfr1)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   103745770 (Fgfr1)
CD molecules [BR:ngi04090]
 Proteins
  103745770 (Fgfr1)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103745770 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF4611
Other DBs
NCBI-GeneID: 103745770
NCBI-ProteinID: XP_008845991
LinkDB
Position
Un
AA seq 1073 aa
MGWERASPRASLAQSAPAGTVVAAAAGGAERERDAGAAAARRGRRAARGAGRSRPGWTET
VLSALRRPRLSRPQARAAAGRAAGIRDFSRVPRRSAGRTAPVLQSGAPWPPRGDGTRSAS
SLRRRRRVLEKGAHVLGTPGGGPEPSPRAPPPGHQLRLHCSRPGWRRPAPNAAGSRASAA
DLLPPGQDPNGARGQRAGAGDADTQRVACASASSPEAEPQRQVRVSLRRQIKLKVEYPWR
CGALLPTSNCRTGMWSWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESLLVHP
GDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPS
GSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHA
VPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGN
YTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHI
QWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSI
GLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSD
FHSQMAVHKLAKSIPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDP
RWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLI
SEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSH
NPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIH
HIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEEL
FKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDL
SMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANGGLKRR
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggggtgggagagagcgagccctcgcgcctcgctggcgcagagcgctcctgcgggcact
gtagtggcggcggcggctggtggcgccgagcgggagcgggacgccggtgcagccgcagcg
cgacgaggaaggcgggctgcgcgcggagccgggcggtcacgtccgggctggaccgagact
gtgcttagcgcattgcggcgacctcgcctttcccggccgcaagcgcgcgccgcagctgga
agagcggcggggatccgggacttttctcgggtcccaaggcgctccgcagggcgcaccgca
cccgtgctgcagtccggcgctccgtggcccccgcggggcgatggaacccggtcggccagc
agcctgaggcgccgccgccgggttctagagaagggggcgcacgttctggggaccccgggc
ggcggacccgagccctccccccgcgccccgcctccggggcaccagcttcggctccattgt
tcccgcccgggctggaggcgcccggctccgaacgccgccgggagtcgtgcctcggccgca
gacctcttgccgccaggccaggacccgaacggagcccggggacaacgggccggagctgga
gacgccgacacccagcgggtcgcctgcgcctcggcgagctctccagaggcggaaccgcag
cgccaagtgagagtcagcttgagaaggcagatcaagctcaaggtggagtatccatggagg
tgtggagccttgttaccaacttctaactgcagaactgggatgtggagctggaagtgtctc
ctcttctgggctgtgctggtcacagccacactctgcactgccaggccagccccaaccttg
cctgaacaagctcagccctggggagcccctgtggaagtggagtcccttctggtccaccct
ggtgacctgctgcagctgcgttgtcggctgcgggacgatgtacagagcatcaactggctg
cgggacggggtgcagctggtggaaagcaaccgcacccgcatcacaggggaggaggtggag
gtgcgggattccgtccctgctgactctggcctctacgcttgcgtgaccagcagcccctct
ggcagcgacaccacctacttctccgtcaatgtctcagatgcactcccctcctcagaggat
gatgatgatgacgacgactcctcctcagaggagaaagagacagataacaccaaaccaaac
cgtaggcctgtagctccatactggacatccccagaaaagatggaaaagaaactacatgcc
gtgccggctgccaagactgtgaagttcaaatgcccatccagtgggacacccaaccccact
ttgcgctggctgaaaaatggcaaagaattcaaacccgaccacaggattggaggctataag
gtccgttacgctacctggagcatcataatggactccgtggtgccctctgacaagggcaac
tacacctgtatcgtggagaatgagtatggcagcattaaccacacctaccagcttgatgtt
gtggagcggtcccctcacaggcccattctgcaggcagggttgcctgccaacaagacagtg
gccctgggcagcaatgtggagttcatgtgtaaggtgtatagtgacccacagccccatatc
cagtggctaaagcacatcgaggtgaatgggagtaagattggcccggacaacctgccttat
gtccagatcctgaagactgctggagttaataccaccgacaaagagatggaggtgctccac
ttacgaaatgtctcctttgaggatgcaggggagtatacgtgcttggcgggtaactctatc
ggactctcccatcactctgcatggttgaccgttctggaagccctggaagagagaccagcc
gtgatgacttcgcccctctacctggagatcatcatctactgcactggggctttccttatc
tcctgtatggtgggctctgtcatcatctacaagatgaagagtggcaccaagaagagcgac
ttccatagccagatggctgtgcacaagctggccaagagcatccctctgcgcagacaggtg
tcagctgactccagtgcctccatgaactctggggttcttctggttcggccttcacgactt
tcctccagtgggactcccatgctagctggtgtctctgaatacgagcttcctgaagatcct
cgctgggagctgccccgagacagactggtcttaggcaaacctcttggagagggctgcttt
ggacaggtggtattggcagaggccatcgggctggacaaagacaaacccaaccgtgtgacc
aaagtggctgtgaagatgttgaaatctgatgcaacagagaaggacttgtcagacctgatc
tcagagatggagatgatgaagatgatcggaaagcacaagaacatcatcaacctcctgggg
gcctgcacgcaggatggtcctctgtatgtcattgtggagtatgcctccaagggcaacctt
cgagagtatctgcaggcccggaggccccctgggctggaatactgctacaaccccagccac
aaccctgaagaacagctgtcctccaaggatctggtatcctgtgcctatcaggtggcccgg
ggcatggagtatcttgcctcaaagaagtgcatacaccgagacctggctgccaggaatgtc
ctggtgacagaggacaacgtgatgaagattgcagactttggcctagctcgagacattcac
cacatcgactactataaaaagactaccaatggccggctgcctgtgaagtggatggcacct
gaggcattgtttgaccggatctacacccaccagagtgacgtgtggtcttttggtgtactt
ttgtgggaaatcttcactctgggtggctccccatatcctggtgtgcctgtggaggaactt
ttcaagctgctgaaggagggtcatcgaatggacaagcccagtaactgcaccaatgagctg
tacatgatgatgcgggactgttggcatgcagtgccttctcagaggcctaccttcaagcag
ctggtggaagacctggaccgcattgtggccttgacctccaatcaggagtatctggacctg
tcgatgcctctggaccagtactctcccagctttcccgatacccggagctctacctgctct
tcaggggaggactctgtcttctctcatgagccgctaccagaggagccctgtctgccccga
caccctactcagcttgccaatggtggacttaaaagacgctga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747076
Entry
103747076         CDS       T03372                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747076 (Pdgfrb)
   04014 Ras signaling pathway
    103747076 (Pdgfrb)
   04015 Rap1 signaling pathway
    103747076 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    103747076 (Pdgfrb)
   04020 Calcium signaling pathway
    103747076 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    103747076 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    103747076 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103747076 (Pdgfrb)
   04540 Gap junction
    103747076 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103747076 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747076 (Pdgfrb)
   05206 MicroRNAs in cancer
    103747076 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    103747076 (Pdgfrb)
   05231 Choline metabolism in cancer
    103747076 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    103747076 (Pdgfrb)
   05218 Melanoma
    103747076 (Pdgfrb)
   05215 Prostate cancer
    103747076 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103747076 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103747076 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747076 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103747076 (Pdgfrb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103747076 (Pdgfrb)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103747076 (Pdgfrb)
CD molecules [BR:ngi04090]
 Proteins
  103747076 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 103747076
NCBI-ProteinID: XP_008847605
LinkDB
Position
Un
AA seq 1109 aa
MGIMGLPGVMPALILKGQLQLLPLLWLLGPQSSQTLVITPPGPQLVLNISSTFVLTCSGS
APVMWEQMSQVPSQKVAMTQDGNFSSMLTLTNVTGGDTGEYFCAYNNSLGPELSERKRIY
IFVPDPTMGFLPVDPEELFVFVTEVTETIIPCRVTDPHLEVTLHEKKVDIPLHVPYDHQR
GFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVKTVVRQGETITIMCIV
TGNDVVNFKWTYPRMESGRLVEPVTDYLFEMPSRIGSILRIPNAELNDSGIYTCNVSVSA
NDHGDEKSINITVVESGYVRLLRTLGPVQIAKLHRSRTLQVVFEAYPPPTVLWFKDNHTL
SDSSAGEMALSTRNVSETRYVSELTLVRVKVAEAGYYTMRVFHEDAEAQLSFKLQVNVPV
RVLELSESHPANGEQTIRCRGQGMPQPNVTWSTCRDLKRCPRKLSLPLLGNSSEEESQLE
TNVTFWEEEQVYEVVSMLRLRHVDQPLSVRCMLQNSEGKDVQEVTVVPHSLPFKVVVISA
ILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDPTWELPR
DQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSH
LGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSDKPRPLSAELYS
NALPVGLSLPSHLSLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDN
YVPSAPERTYRSTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEG
KLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIF
TLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLL
LERLLSEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEG
DNDYIIPLPDPKPDTAEEGPLESSPSLASSTLNEVNTSSTISCDSPLDPQEESEQDSQPE
PQTEPEAELEQPQDSKCPGSLAEAEDSFL
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgggcatcatggggcttccaggtgtgatgccagctttgatcctcaaaggccagttgcag
ttgctgcctctgctatggctgctgggaccacagtcctcccagaccctggtcatcacaccc
ccagggccacagcttgtcctcaacatctccagcacttttgttctgacctgctcgggttca
gctccagtgatgtgggaacagatgtcccaggtaccctctcagaaagtggccatgacccag
gatggcaacttctccagcatgctgacactgactaatgttactgggggagacactggagaa
tacttctgtgcctataacaactccctaggaccagagctcagtgagcggaaacgtatctac
atcttcgtgccagatcccaccatgggcttccttcctgtggaccctgaggaattgttcgtc
tttgtcacggaagtaactgagacaataattccatgccgagtgacagacccccacctggag
gtgacactgcatgagaaaaaagtagacatccctctacatgtcccctatgaccaccagcga
ggtttcactggcacctttgaggacaagacttacatctgcaaaaccaccatcggggacagg
gaagtggactccgatacctactatgtctacagcctccaggtgtcatccatcaatgtctct
gtgaatgcagtgaagactgttgtccgccagggtgagacaattaccatcatgtgcatcgtg
actgggaatgatgtggtcaacttcaagtggacataccctcgcatggagagtgggaggctg
gtggagccagtgacagactacttatttgaaatgccctctcgcattggctccatcctgcgt
atccccaatgctgagctgaatgactctgggatctacacttgcaatgtgtcagtgagtgca
aatgaccatggagatgaaaagtccatcaacatcactgtggtcgagagtggctacgtgcgg
ctgctgagaacgctgggtcctgtacaaattgctaagctgcaccggagccggacactgcag
gtggtgttcgaggcttacccgccgcccactgtactgtggtttaaagacaaccacaccttg
agtgactccagcgccggcgagatggccctgtccacgcgcaacgtatctgaaactcgatat
gtgtcagaactgaccctggtgcgggtgaaggtggcagaggctggctactacaccatgagg
gtctttcatgaggatgctgaggcccagctctccttcaagctgcaggtcaatgtccctgtc
cgtgtgctagagctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgt
gggcagggcatgccccaaccaaatgtcacctggtctacatgcagagatctcaaaaggtgt
ccacgaaagctgtcactcccactcctggggaacagttcggaggaggagagccaactggag
actaatgtgactttctgggaagaagaacaggtatacgaggtggtgagcatgcttcgcctg
cgccacgtggaccaaccactgtcagtacgctgtatgctgcagaactcggagggcaaagat
gtgcaagaggtcactgtggtgccacactccctacccttcaaggtggtagtgatctctgcc
attttggccttggtggtcctcaccatcatctccctcatcatcctcattatgctgtggcag
aagaagccacgatatgagatccgatggaaagtgatcgagtctgtgagctctgatggtcac
gagtacatctacgtggaccctgtgcagctaccttatgaccccacatgggagcttccacgg
gaccagcttgtgcttggacgcactctcggttctggggccttcgggcaagtggtggaggcc
acggctcatggtctgagccattcacaggccactatgaaagtggctgtcaagatgctgaaa
tccacagcccgcagcagcgagaagcaagccctcatgtccgagctgaaaatcatgagtcac
ctcgggccccacctgaacgtggtcaacttgctgggggcttgcaccaaaggaggacccatc
tacatcatcacagagtactgccgctatggtgacctggtggactacctgcaccgcaacaag
cacaccttcttgcagcgccactctgacaagccccgcccactcagtgctgagctgtacagc
aatgcgctgccagtggggctctccctgcccagccacttgtccctgactggggagagtgat
ggtggttacatggacatgagcaaggatgagtctgtggactatgtgcctatgctggacatg
aaaggagacataaaatacgcagacatcgagtcctccaactacatggccccttatgataac
tatgtcccatctgcccctgagagaacctatcggtccaccctgatcaacgagtcaccagtg
cttagctacacagacctcgtgggcttcagctaccaggtggccaatggcatggagttcttg
gcctctaagaattgtgttcaccgagacctggcggccaggaatgtgctcatctgtgagggc
aagctggtcaagatctgtgactttggcctggctcgagacatcatgcgtgactcgaactac
atctccaaaggcagcaccttcctgcctctgaagtggatggcccctgagagcatcttcaac
agcctctacaccaccctgagtgacgtgtggtcctttgggatcctactctgggagatcttc
acactgggtggtactccttacccagagctgcccatgaacgagcagttctacaatgccatc
aagcggggctaccgcatggcccagcctgcccatgcctctgacgagatctatgagatcatg
cagaagtgctgggaagagaagtttgagattcggccccccttctcccagctggtgctactt
ctggagaggctgctgagcgagggttacaaaaagaagtaccagcaagtagatgaggagttt
ctgaggagtgaccacccagccatcctacgctcccaagccagattacctggattccatggc
cttcgatcccctctggacaccagctctgttctctacactgctgtgcagcccaatgagggt
gacaacgactacatcatccccttgcctgaccccaagccagacactgctgaggagggcccc
ctggagagttcccctagcctggccagctccaccttgaatgaagtcaacacttcctcaacc
atctcctgtgacagccccctggacccccaagaagagtcagagcaggattcccagccggag
ccccaaacagagcctgaggcagagctggagcagccacaagattctaaatgccctggatct
ctggctgaagcagaggacagcttcctgtag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748852
Entry
103748852         CDS       T03372                                 

Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04012  ErbB signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04934  Cushing syndrome
ngi05160  Hepatitis C
ngi05163  Human cytomegalovirus infection
ngi05165  Human papillomavirus infection
ngi05171  Coronavirus disease - COVID-19
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05212  Pancreatic cancer
ngi05213  Endometrial cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05223  Non-small cell lung cancer
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748852
   04012 ErbB signaling pathway
    103748852
   04014 Ras signaling pathway
    103748852
   04015 Rap1 signaling pathway
    103748852
   04630 JAK-STAT signaling pathway
    103748852
   04066 HIF-1 signaling pathway
    103748852
   04068 FoxO signaling pathway
    103748852
   04020 Calcium signaling pathway
    103748852
   04072 Phospholipase D signaling pathway
    103748852
   04151 PI3K-Akt signaling pathway
    103748852
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103748852
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103748852
   04520 Adherens junction
    103748852
   04540 Gap junction
    103748852
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103748852
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103748852
   04915 Estrogen signaling pathway
    103748852
   04921 Oxytocin signaling pathway
    103748852
   04926 Relaxin signaling pathway
    103748852
   04928 Parathyroid hormone synthesis, secretion and action
    103748852
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103748852
   05206 MicroRNAs in cancer
    103748852
   05205 Proteoglycans in cancer
    103748852
   05230 Central carbon metabolism in cancer
    103748852
   05231 Choline metabolism in cancer
    103748852
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103748852
  09162 Cancer: specific types
   05210 Colorectal cancer
    103748852
   05212 Pancreatic cancer
    103748852
   05225 Hepatocellular carcinoma
    103748852
   05226 Gastric cancer
    103748852
   05214 Glioma
    103748852
   05218 Melanoma
    103748852
   05219 Bladder cancer
    103748852
   05215 Prostate cancer
    103748852
   05213 Endometrial cancer
    103748852
   05224 Breast cancer
    103748852
   05223 Non-small cell lung cancer
    103748852
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103748852
  09172 Infectious disease: viral
   05160 Hepatitis C
    103748852
   05171 Coronavirus disease - COVID-19
    103748852
   05163 Human cytomegalovirus infection
    103748852
   05165 Human papillomavirus infection
    103748852
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103748852
   01522 Endocrine resistance
    103748852
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103748852
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103748852
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103748852
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103748852
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103748852
  Exosomal proteins of pancreatic cancer cells
   103748852
  Exosomal proteins of bladder cancer cells
   103748852
SSDB
Motif
Pfam: Recep_L_domain Furin-like GF_recep_IV
Other DBs
NCBI-GeneID: 103748852
NCBI-ProteinID: XP_008849862
LinkDB
Position
Un
AA seq 544 aa
MLLSGTAGTALLALLAALLAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNALYENTYALA
VLSNYGTNKTGLRELPMRNLQEILLGAVRFSNNPILCNVETIQWRDIVNIDFMSNMSMDL
QNHLSSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSRRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCHKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKTCPRNYV
VTDHGSCVRACGPDNFEVEEDGVRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTAISGDLHILPVAFKGDSFTHTPPLDPKELNILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISTNQNLCYANTINWKKL
FGTSSQKTKIQYNRAENDCKATGHVCNPLCSLEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILDG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgctactctcggggactgcggggaccgcgctgctggcgctgctggccgcgctcctggcc
gcaggtggggcgctggaggaaaagaaagtttgccaaggcacgagtaacaggctcacccag
ctgggcacttttgaagaccactttctgagtctgcagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaatcacttacgtgcaaaggaattatgacctttccttcttaaag
accattcaggaggttgctggctatgtgctcattgcactcaacactgtggagaagatccct
ttggagaacctgcagatcatcagaggaaatgctctatatgaaaacacctatgccttagcc
gtcctgtccaactacgggacgaacaaaactgggctgagggagctgcccatgcggaactta
caggaaatcctgcttggtgctgtgcgattcagcaacaaccctatcctctgcaatgtggag
actatccagtggagggacatcgtcaacatcgactttatgagcaacatgtcaatggactta
cagaaccatctgagcagctgccaaaaatgtgacccaggctgtcccaatggaagctgttgg
ggtgcaggagaggaaaactgccagaaactgaccaaaatcatctgtgcccagcagtgttcc
cggcgctgccgtggcaagtctcccagtgactgctgtcacaaccagtgtgccgctggctgc
acagggccccgagagagcgactgcctggtttgccacaagttccgggatgaggccacatgc
aaggatacctgcccaccgctcatgctgtacaaccccaccacataccagatggatgtcaac
cctgaggggaagtacagctttggtgccacctgtgtgaagacatgcccccgaaactacgtg
gtgacagatcatggttcatgtgtccgcgcctgcggtcctgataactttgaagtggaagaa
gacggtgttcgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgcaatggcata
ggcattggtgaatttaaagacacactctccataaatgctaccaatatcaaacacttcaaa
aactgcactgccatcagtggagatctccacatcctgccggtggcatttaagggggactcc
ttcacacacactcctcctctagacccaaaggaactgaatatcctaaaaaccgtaaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgaccttcatgctttt
gagaacctagaaattatacgtggcaggacaaagcaacatggtcagttttctcttgcggtt
gtcggcctgaacataacatcattgggattgcgttcccttaaggaaataagtgatggtgat
gtgataatttcaacaaaccaaaatttgtgttatgcaaatacaataaactggaaaaaacta
tttgggacttccagtcagaaaaccaaaattcaatacaacagagctgaaaatgactgcaag
gctacaggccacgtctgtaatcctttatgttccctggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaacgtcagccggggcagggaatgcgtggagaagtgcaac
atcctggatgggtga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103749467
Entry
103749467         CDS       T03372                                 

Gene name
Igf1r
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi01522  Endocrine resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04068  FoxO signaling pathway
ngi04114  Oocyte meiosis
ngi04140  Autophagy - animal
ngi04144  Endocytosis
ngi04150  mTOR signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04152  AMPK signaling pathway
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi04510  Focal adhesion
ngi04520  Adherens junction
ngi04550  Signaling pathways regulating pluripotency of stem cells
ngi04730  Long-term depression
ngi04913  Ovarian steroidogenesis
ngi04914  Progesterone-mediated oocyte maturation
ngi05200  Pathways in cancer
ngi05202  Transcriptional misregulation in cancer
ngi05205  Proteoglycans in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05224  Breast cancer
ngi05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103749467 (Igf1r)
   04014 Ras signaling pathway
    103749467 (Igf1r)
   04015 Rap1 signaling pathway
    103749467 (Igf1r)
   04066 HIF-1 signaling pathway
    103749467 (Igf1r)
   04068 FoxO signaling pathway
    103749467 (Igf1r)
   04151 PI3K-Akt signaling pathway
    103749467 (Igf1r)
   04152 AMPK signaling pathway
    103749467 (Igf1r)
   04150 mTOR signaling pathway
    103749467 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103749467 (Igf1r)
   04140 Autophagy - animal
    103749467 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103749467 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103749467 (Igf1r)
   04520 Adherens junction
    103749467 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    103749467 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103749467 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    103749467 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    103749467 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    103749467 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    103749467 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103749467 (Igf1r)
   05202 Transcriptional misregulation in cancer
    103749467 (Igf1r)
   05205 Proteoglycans in cancer
    103749467 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103749467 (Igf1r)
   05214 Glioma
    103749467 (Igf1r)
   05218 Melanoma
    103749467 (Igf1r)
   05215 Prostate cancer
    103749467 (Igf1r)
   05224 Breast cancer
    103749467 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103749467 (Igf1r)
   01522 Endocrine resistance
    103749467 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103749467 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103749467 (Igf1r)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103749467 (Igf1r)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103749467 (Igf1r)
CD molecules [BR:ngi04090]
 Proteins
  103749467 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 103749467
NCBI-ProteinID: XP_008850569
LinkDB
Position
Un
AA seq 1368 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPQKECGD
LCPGTLEEKPICEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIQSAESTDSYGFVIHD
GECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRMILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTIKSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTVTDIYNITDPEELETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFIHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEIENNPVLSPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIISSIKDEMEPGFREVSFYYSEENKPPEPEELELEPENMESVPLDPSASSASLPLPDR
HSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggcctgggatcgacatccgc
aatgactatcagcagctgaagcgtctggagaactgcacggtgattgagggcttcctccat
atcctgctcatctccaaggctgaggactaccgcagctaccgcttccccaagcttacagtc
atcaccgaatacttgctgctgtttcgtgttgccggcctcgagagcctgggagatctcttc
ccgaacctcacggtcatccgtggctggaaactcttctacaactacgcactggtcatcttt
gagatgaccaacctcaaggatattgggctttataatctgaggaacattactcggggggct
atcaggattgagaaaaatgctgacctctgttacctctccacggtggactggtccctcatc
ttggatgctgtgtccaataactacattgtggggaacaagccccagaaggagtgtggggac
ctgtgtccagggaccttggaggagaagccaatctgcgagaagaccaccatcaataatgaa
tacaactaccgctgttggaccacaaatcgctgccagaaaatgtgccctagtgtgtgtggg
aagcgagcatgcacggagaacaatgagtgctgccacccagaatgcctgggcagctgccac
acacctgatgacaacacaacctgcgtggcctgccggcactactactacaaaggcgtgtgc
gtgcctgcctgcccgcctggcacctacaggtttgagggctggcgctgtgtggaccgagat
ttctgtgccaacatccagagtgctgagagcactgactcctatggcttcgttatccacgac
ggcgagtgtatgcaggagtgcccctcaggcttcatccgcaacagcacccagagcatgtac
tgcatcccctgtgaaggcccttgccccaaggtctgtggtgatgaagaaaagaaaacaaaa
accatcgattcagttacttctgctcaaatgctccaaggatgtaccatcttgaagggcaat
ttgcttattaatatccggcgaggcaataacatcgcctcagaactggagaatttcatgggg
ctcatcgaggtggtgacgggctatgtgaagatccgccattcccacgccctggtgtctttg
tcctttctgaaaaacctccgcatgatcttaggagaggagcaactggaaggaaactattcc
ttttatgtcctggacaaccagaacttgcagcagctgtgggactggaaccaccgcaacctg
accatcaagtcagggaagatgtactttgctttcaatcccaagctgtgtgtttctgaaatt
taccgcatggaggaagtaacaggaacaaaagggcgccagagcaaaggggacataaacacc
aggaacaacggagagcgagcctcctgtgaaagtgatgttctgcgtttcacctcaaccacc
acctggaagaaccgcattatcataacctggcaccggtaccgaccccccgactacagggat
ctcatcagcttcacggtttactacaaggaggcaccttttaaaaatgttacagaatatgat
gggcaggatgcctgtggctctaacagctggaacatggtggatgtggacctgcctcccaac
aaggagggggagcccggcattttattgcatgggctgaagccctggacccagtacgccgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccatatccgtggggccaagagt
gaaatcttatacattcgcaccaatgcttcagtaccttccattcccctggatgttctttca
gcatcaaactcctcctctcagctgattgtaaagtggaatcccccatctctgcccaacggg
aacctgagttactacattgtgaggtggcagcggcagccacaggatggctacctctacagg
cacaactactgctccaaagacaaaatccccatcagaaagtatgctgacggcaccattgat
gtggaagaggtgacagaaaatcccaagaccgaagtgtgtggtggggataaaggaccatgc
tgtgcttgtcccaaaactgaagctgagaagcaggccgagaaggaggaggctgagtaccgc
aaagtcttcgagaatttccttcacaactccatcttcgtgcccagacctgaaaggaaacgg
agagatgtcatgcaagtggccaacaccaccatgtccagtcgaagcaggaacaccacggtg
actgacatctataatatcacagacccagaagagcttgagacagaataccctttcttcgag
agcagagtggataataaggagagaactgtcatttccaacctccgacctttcactctatat
cgcatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagtgcctccaac
tttgtctttgcaagaaccatgcctgcagaaggagcagatgatattcctggaccagtgact
tgggaaccaaggcctgaaaactccatctttttaaagtggccagaacctgagaaccctaac
ggattgattctcatgtatgaaataaaatacggatcacaagttgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtatggaggggccaagcttaaccggctaaacccaggg
aactatacagcccggattcaggctacctctctctctgggaatgggtcatggacggatcct
gtgttcttctatgtcccggccaaaacaacgtatgagaatttcatccatctgatcattgct
ctgccggtcgccatcctgctgatcgtgggcgggctggtgatcatgttgtacgtcttccat
aggaagagaaataacagcagattggggaatggggtgctgtatgcctctgtgaacccagaa
tatttcagtgcagccgatgtgtacgtgcctgatgaatgggaggttgctcgagagaagatc
accatgaaccgggagcttgggcagggatcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggacgaacctgaaaccagggtagccatcaagacagtaaatgaggctgca
agcatgcgtgaaaggatagagtttctgaacgaggcctcagtgatgaaggagttcaactgt
caccatgtggtgcggttgctgggcgtggtgtcccagggccagcctaccctggtcatcatg
gaactaatgacacgcggggatctcaaaagttatctcaggtctctgaggccagaaatagag
aataatccagtcctatcacctccaagtttaagcaagatgatccagatggctggagagatt
gcagatggcatggcatacctcaatgcgaacaagtttgtccacagagatcttgctgcgcgg
aattgcatggtagctgaagatttcaccgtcaaaattggagattttggtatgacacgagac
atctatgagacagactactaccggaaaggagggaaggggttactgcctgtgcgctggatg
tctcctgagtccctcaaggatggagtcttcactactcattcagatgtctggtcctttggt
gtcgtcctctgggagattgccacattggctgagcagccataccaaggcttgtccaatgag
caagtccttcgcttcgtcatggagggtggccttctggacaaaccggacaactgccccgac
atgctatttgaactgatgcgcatgtgctggcagtacaaccccaagatgcggccttccttc
ctggagatcatcagcagcatcaaggacgagatggagcccggctttcgagaggtctccttc
tactacagcgaggagaacaagccacccgagccggaggagctggagctggagcccgagaac
atggagagcgtccccctggacccttcggcctcctcagcctccctgccactgcctgataga
cactcaggacacaaggccgagaacggcccaggccctggagtgctggttctccgcgccagc
ttcgatgagagacagccttatgcgcacatgaacgggggtcgagccaacgagagggccttg
ccgctgccccagtcttcgacctgctga

DBGET integrated database retrieval system