KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734393
Entry
103734393         CDS       T03372                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04144  Endocytosis
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05163  Human cytomegalovirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734393 (Pdgfra)
   04014 Ras signaling pathway
    103734393 (Pdgfra)
   04015 Rap1 signaling pathway
    103734393 (Pdgfra)
   04630 JAK-STAT signaling pathway
    103734393 (Pdgfra)
   04020 Calcium signaling pathway
    103734393 (Pdgfra)
   04072 Phospholipase D signaling pathway
    103734393 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    103734393 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103734393 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103734393 (Pdgfra)
   04540 Gap junction
    103734393 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103734393 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734393 (Pdgfra)
   05206 MicroRNAs in cancer
    103734393 (Pdgfra)
   05230 Central carbon metabolism in cancer
    103734393 (Pdgfra)
   05231 Choline metabolism in cancer
    103734393 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    103734393 (Pdgfra)
   05218 Melanoma
    103734393 (Pdgfra)
   05215 Prostate cancer
    103734393 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103734393 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103734393 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103734393 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103734393 (Pdgfra)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103734393 (Pdgfra)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103734393 (Pdgfra)
CD molecules [BR:ngi04090]
 Proteins
  103734393 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE DUF3912 Kinase-like
Other DBs
NCBI-GeneID: 103734393
NCBI-ProteinID: XP_008831544
LinkDB
Position
Un
AA seq 1088 aa
MGTFHWAFLVFGCLLTGPSLILCQLLLPSILPNENEKVVQLNSSFSLRCFGESEVSWQHP
MSEEEDPDVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETHVTLYNEGRLVFASYDSKQGFNG
TFSVGPYICEATVQGKTFQTNAFNVYALKATSELNLEMEAHQTVYKSGETIMVTCAVFNN
EVVDLQWTYPGEVKNKGITMLEEIKVPSIKLVYTLTVPKATVKDSGDYECAARQATKEVK
EMKTVTISVHEKGFVEIKPTFGQLEAVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVKKIQETRYQSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCTAAGTPLPDIEWMICKDIKKCNNDTSWTTLANNISNIPTELHRRG
RSTVEGRVTFAKVEETIAVRCVAKNHLGNGNRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEDDKLKDWEGGVDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgggaactttccactgggccttcctggtcttcggctgtctcctcacagggccgagcctc
atcctctgccagctcttattaccctctatcctcccaaatgagaacgagaaggttgtgcag
ctgaattcatccttttctttgagatgctttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagaggaccccgacgtggaaatcagaagtgaggagaacaacagcggcctc
tttgtgacagtgctggaagtggtcaacgcctcggcagcccacaccggatggtacacttgc
tattacaaccacactcagacagaagaaagtgagatagagggcaggcacatttacatctat
gtgccagacccagacatggcctttgtgcctctaggaatgacagattctttagtcattgtg
gaagaagacgattctgccatcataccttgtcgcaccacagatccagagactcatgtaact
ctgtacaatgagggtaggctggtgtttgcctcttacgacagcaagcagggcttcaatggg
accttcagtgtggggccctacatctgtgaggccaccgtccaagggaagacattccagacc
aatgcatttaatgtttatgctttgaaagcaacatcggagctgaatctagagatggaagct
catcaaactgtatataaatcaggagaaacgatcatggtgacctgtgctgtctttaacaat
gaggtggttgatcttcagtggacttaccctggagaagtgaaaaacaaaggcatcaccatg
ctggaagaaattaaggtcccatccatcaaattggtgtacactttgacagtccccaaggcc
acggtgaaagacagtggagattatgagtgtgctgcccgccaggctactaaggaggtcaaa
gaaatgaagacagtcaccatttctgtccatgagaaaggttttgttgagatcaagcccacc
tttggccagctggaagccgtcaacctgcatcaagtcagggagttcgtggtggaggtacaa
gcctaccctactcccaggatatcatggctgaaggacaacttgactctgattgagaatctc
actgagatcaccactgatgtgaaaaagattcaggaaacaaggtatcaaagcaaattaaag
ctgattcgggctaaggaggaagacagtggccattataccatcgtagttcaaaatgaagat
gatgtgaagagctacacttttgagctgtcaactctagttcccgcatccattctggagctg
gttgacgaccatcacggctctggtgggggacagactgtgaggtgcacagctgcaggcaca
cctcttccggacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacact
tcatggacaactttggccaacaatatctcaaatatccccactgagctccaccgccgaggc
aggagtactgtggagggccgagtgacattcgccaaagtcgaggagaccattgcagttcga
tgcgtggcaaagaatcaccttgggaatgggaaccgagaactgaagctggtggctcccacc
ctgcgttctgagcttacagtagcagctgcagtcttggtgctgttggtgattgtgataatc
tcactcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttattgagtcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctt
ccctatgactccagatgggagttcccaagagatggactagtgcttggtcgaatcctggga
tctggtgcatttgggaaagtagttgaaggaacagcctatggattaagccggtcccagcct
gttatgaaggtagcagtgaagatgctcaaacccacagccagatccagtgaaaagcaagct
ctcatgtctgagctgaagataatgactcacttgggaccacatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccctatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaacagagatagcttcctgagccgacacccagagaag
ccaaagaaagagctggacatctttggattgaaccctgctgatgaaagtacaaggagttat
gtgattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatattcagacatccaaagatcg
ctgtatgatcgtccagcctcctataagaagaaatctatgctagactcagaagtcaaaaat
ctcctttcagatgactcggaaggccttactttgctggatttgttgagcttcacctatcaa
gttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacttggctgcc
cgcaatgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggccaga
gatattatgcatgattcaaactacgtgtcaaaaggcagcaccttcctgcctgtgaagtgg
atggcccctgagagcatctttgacaacctatacaccaccctgagtgatgtctggtcttat
ggcattctcctttgggagatcttttctcttggtggcacaccctaccctggcatgatggta
gattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccatgcc
accagtgaagtctatgagattatggtacagtgctggaacagtgagccagagaagagaccc
tccttctaccatctgagtgagatagtggagaatctgttgcctggacaatataaaaagagt
tatgaaaagattcacctggacttcctgaaaagtgatcaccctgctgtggcacgcatgcgt
gtggactccgacaatgcgtacattggtgtcacctacaaaaatgaagacgacaagctgaag
gactgggagggtggcgtggatgagcagagactgagtgctgacagtggctacatcatccct
ctgccagatattgaccctgttccagaggaggaagacctgggcaagagaaacagacacagc
tcccagacctctgaagagagtgccattgagacaggttccagcagttccaccttcatcaag
agagaggacgagaccattgaggacattgacatgatggatgacattggcatagactcctca
gacctggtggaggacagcttcctgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103747076
Entry
103747076         CDS       T03372                                 

Gene name
Pdgfrb
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01521  EGFR tyrosine kinase inhibitor resistance
ngi04010  MAPK signaling pathway
ngi04014  Ras signaling pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04072  Phospholipase D signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04510  Focal adhesion
ngi04540  Gap junction
ngi04630  JAK-STAT signaling pathway
ngi04810  Regulation of actin cytoskeleton
ngi05165  Human papillomavirus infection
ngi05200  Pathways in cancer
ngi05206  MicroRNAs in cancer
ngi05214  Glioma
ngi05215  Prostate cancer
ngi05218  Melanoma
ngi05230  Central carbon metabolism in cancer
ngi05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103747076 (Pdgfrb)
   04014 Ras signaling pathway
    103747076 (Pdgfrb)
   04015 Rap1 signaling pathway
    103747076 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    103747076 (Pdgfrb)
   04020 Calcium signaling pathway
    103747076 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    103747076 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    103747076 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103747076 (Pdgfrb)
   04540 Gap junction
    103747076 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103747076 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103747076 (Pdgfrb)
   05206 MicroRNAs in cancer
    103747076 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    103747076 (Pdgfrb)
   05231 Choline metabolism in cancer
    103747076 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    103747076 (Pdgfrb)
   05218 Melanoma
    103747076 (Pdgfrb)
   05215 Prostate cancer
    103747076 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103747076 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103747076 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ngi01001]
    103747076 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ngi04090]
    103747076 (Pdgfrb)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103747076 (Pdgfrb)
Protein kinases [BR:ngi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103747076 (Pdgfrb)
CD molecules [BR:ngi04090]
 Proteins
  103747076 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 103747076
NCBI-ProteinID: XP_008847605
LinkDB
Position
Un
AA seq 1109 aa
MGIMGLPGVMPALILKGQLQLLPLLWLLGPQSSQTLVITPPGPQLVLNISSTFVLTCSGS
APVMWEQMSQVPSQKVAMTQDGNFSSMLTLTNVTGGDTGEYFCAYNNSLGPELSERKRIY
IFVPDPTMGFLPVDPEELFVFVTEVTETIIPCRVTDPHLEVTLHEKKVDIPLHVPYDHQR
GFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVKTVVRQGETITIMCIV
TGNDVVNFKWTYPRMESGRLVEPVTDYLFEMPSRIGSILRIPNAELNDSGIYTCNVSVSA
NDHGDEKSINITVVESGYVRLLRTLGPVQIAKLHRSRTLQVVFEAYPPPTVLWFKDNHTL
SDSSAGEMALSTRNVSETRYVSELTLVRVKVAEAGYYTMRVFHEDAEAQLSFKLQVNVPV
RVLELSESHPANGEQTIRCRGQGMPQPNVTWSTCRDLKRCPRKLSLPLLGNSSEEESQLE
TNVTFWEEEQVYEVVSMLRLRHVDQPLSVRCMLQNSEGKDVQEVTVVPHSLPFKVVVISA
ILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDPTWELPR
DQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSH
LGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSDKPRPLSAELYS
NALPVGLSLPSHLSLTGESDGGYMDMSKDESVDYVPMLDMKGDIKYADIESSNYMAPYDN
YVPSAPERTYRSTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEG
KLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIF
TLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLL
LERLLSEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEG
DNDYIIPLPDPKPDTAEEGPLESSPSLASSTLNEVNTSSTISCDSPLDPQEESEQDSQPE
PQTEPEAELEQPQDSKCPGSLAEAEDSFL
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgggcatcatggggcttccaggtgtgatgccagctttgatcctcaaaggccagttgcag
ttgctgcctctgctatggctgctgggaccacagtcctcccagaccctggtcatcacaccc
ccagggccacagcttgtcctcaacatctccagcacttttgttctgacctgctcgggttca
gctccagtgatgtgggaacagatgtcccaggtaccctctcagaaagtggccatgacccag
gatggcaacttctccagcatgctgacactgactaatgttactgggggagacactggagaa
tacttctgtgcctataacaactccctaggaccagagctcagtgagcggaaacgtatctac
atcttcgtgccagatcccaccatgggcttccttcctgtggaccctgaggaattgttcgtc
tttgtcacggaagtaactgagacaataattccatgccgagtgacagacccccacctggag
gtgacactgcatgagaaaaaagtagacatccctctacatgtcccctatgaccaccagcga
ggtttcactggcacctttgaggacaagacttacatctgcaaaaccaccatcggggacagg
gaagtggactccgatacctactatgtctacagcctccaggtgtcatccatcaatgtctct
gtgaatgcagtgaagactgttgtccgccagggtgagacaattaccatcatgtgcatcgtg
actgggaatgatgtggtcaacttcaagtggacataccctcgcatggagagtgggaggctg
gtggagccagtgacagactacttatttgaaatgccctctcgcattggctccatcctgcgt
atccccaatgctgagctgaatgactctgggatctacacttgcaatgtgtcagtgagtgca
aatgaccatggagatgaaaagtccatcaacatcactgtggtcgagagtggctacgtgcgg
ctgctgagaacgctgggtcctgtacaaattgctaagctgcaccggagccggacactgcag
gtggtgttcgaggcttacccgccgcccactgtactgtggtttaaagacaaccacaccttg
agtgactccagcgccggcgagatggccctgtccacgcgcaacgtatctgaaactcgatat
gtgtcagaactgaccctggtgcgggtgaaggtggcagaggctggctactacaccatgagg
gtctttcatgaggatgctgaggcccagctctccttcaagctgcaggtcaatgtccctgtc
cgtgtgctagagctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgt
gggcagggcatgccccaaccaaatgtcacctggtctacatgcagagatctcaaaaggtgt
ccacgaaagctgtcactcccactcctggggaacagttcggaggaggagagccaactggag
actaatgtgactttctgggaagaagaacaggtatacgaggtggtgagcatgcttcgcctg
cgccacgtggaccaaccactgtcagtacgctgtatgctgcagaactcggagggcaaagat
gtgcaagaggtcactgtggtgccacactccctacccttcaaggtggtagtgatctctgcc
attttggccttggtggtcctcaccatcatctccctcatcatcctcattatgctgtggcag
aagaagccacgatatgagatccgatggaaagtgatcgagtctgtgagctctgatggtcac
gagtacatctacgtggaccctgtgcagctaccttatgaccccacatgggagcttccacgg
gaccagcttgtgcttggacgcactctcggttctggggccttcgggcaagtggtggaggcc
acggctcatggtctgagccattcacaggccactatgaaagtggctgtcaagatgctgaaa
tccacagcccgcagcagcgagaagcaagccctcatgtccgagctgaaaatcatgagtcac
ctcgggccccacctgaacgtggtcaacttgctgggggcttgcaccaaaggaggacccatc
tacatcatcacagagtactgccgctatggtgacctggtggactacctgcaccgcaacaag
cacaccttcttgcagcgccactctgacaagccccgcccactcagtgctgagctgtacagc
aatgcgctgccagtggggctctccctgcccagccacttgtccctgactggggagagtgat
ggtggttacatggacatgagcaaggatgagtctgtggactatgtgcctatgctggacatg
aaaggagacataaaatacgcagacatcgagtcctccaactacatggccccttatgataac
tatgtcccatctgcccctgagagaacctatcggtccaccctgatcaacgagtcaccagtg
cttagctacacagacctcgtgggcttcagctaccaggtggccaatggcatggagttcttg
gcctctaagaattgtgttcaccgagacctggcggccaggaatgtgctcatctgtgagggc
aagctggtcaagatctgtgactttggcctggctcgagacatcatgcgtgactcgaactac
atctccaaaggcagcaccttcctgcctctgaagtggatggcccctgagagcatcttcaac
agcctctacaccaccctgagtgacgtgtggtcctttgggatcctactctgggagatcttc
acactgggtggtactccttacccagagctgcccatgaacgagcagttctacaatgccatc
aagcggggctaccgcatggcccagcctgcccatgcctctgacgagatctatgagatcatg
cagaagtgctgggaagagaagtttgagattcggccccccttctcccagctggtgctactt
ctggagaggctgctgagcgagggttacaaaaagaagtaccagcaagtagatgaggagttt
ctgaggagtgaccacccagccatcctacgctcccaagccagattacctggattccatggc
cttcgatcccctctggacaccagctctgttctctacactgctgtgcagcccaatgagggt
gacaacgactacatcatccccttgcctgaccccaagccagacactgctgaggagggcccc
ctggagagttcccctagcctggccagctccaccttgaatgaagtcaacacttcctcaacc
atctcctgtgacagccccctggacccccaagaagagtcagagcaggattcccagccggag
ccccaaacagagcctgaggcagagctggagcagccacaagattctaaatgccctggatct
ctggctgaagcagaggacagcttcctgtag

DBGET integrated database retrieval system