KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734421
Entry
103734421         CDS       T03372                                 

Gene name
Gnaq
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04062  Chemokine signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04261  Adrenergic signaling in cardiomyocytes
ngi04270  Vascular smooth muscle contraction
ngi04371  Apelin signaling pathway
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04720  Long-term potentiation
ngi04723  Retrograde endocannabinoid signaling
ngi04724  Glutamatergic synapse
ngi04725  Cholinergic synapse
ngi04726  Serotonergic synapse
ngi04728  Dopaminergic synapse
ngi04730  Long-term depression
ngi04750  Inflammatory mediator regulation of TRP channels
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04915  Estrogen signaling pathway
ngi04916  Melanogenesis
ngi04918  Thyroid hormone synthesis
ngi04921  Oxytocin signaling pathway
ngi04922  Glucagon signaling pathway
ngi04924  Renin secretion
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi04961  Endocrine and other factor-regulated calcium reabsorption
ngi04970  Salivary secretion
ngi04971  Gastric acid secretion
ngi04972  Pancreatic secretion
ngi05010  Alzheimer disease
ngi05016  Huntington disease
ngi05017  Spinocerebellar ataxia
ngi05022  Pathways of neurodegeneration - multiple diseases
ngi05135  Yersinia infection
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103734421 (Gnaq)
   04371 Apelin signaling pathway
    103734421 (Gnaq)
   04020 Calcium signaling pathway
    103734421 (Gnaq)
   04071 Sphingolipid signaling pathway
    103734421 (Gnaq)
   04022 cGMP-PKG signaling pathway
    103734421 (Gnaq)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103734421 (Gnaq)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103734421 (Gnaq)
   04062 Chemokine signaling pathway
    103734421 (Gnaq)
  09152 Endocrine system
   04911 Insulin secretion
    103734421 (Gnaq)
   04922 Glucagon signaling pathway
    103734421 (Gnaq)
   04929 GnRH secretion
    103734421 (Gnaq)
   04912 GnRH signaling pathway
    103734421 (Gnaq)
   04915 Estrogen signaling pathway
    103734421 (Gnaq)
   04921 Oxytocin signaling pathway
    103734421 (Gnaq)
   04935 Growth hormone synthesis, secretion and action
    103734421 (Gnaq)
   04918 Thyroid hormone synthesis
    103734421 (Gnaq)
   04928 Parathyroid hormone synthesis, secretion and action
    103734421 (Gnaq)
   04916 Melanogenesis
    103734421 (Gnaq)
   04924 Renin secretion
    103734421 (Gnaq)
   04925 Aldosterone synthesis and secretion
    103734421 (Gnaq)
   04927 Cortisol synthesis and secretion
    103734421 (Gnaq)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103734421 (Gnaq)
   04270 Vascular smooth muscle contraction
    103734421 (Gnaq)
  09154 Digestive system
   04970 Salivary secretion
    103734421 (Gnaq)
   04971 Gastric acid secretion
    103734421 (Gnaq)
   04972 Pancreatic secretion
    103734421 (Gnaq)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103734421 (Gnaq)
  09156 Nervous system
   04724 Glutamatergic synapse
    103734421 (Gnaq)
   04725 Cholinergic synapse
    103734421 (Gnaq)
   04728 Dopaminergic synapse
    103734421 (Gnaq)
   04726 Serotonergic synapse
    103734421 (Gnaq)
   04720 Long-term potentiation
    103734421 (Gnaq)
   04730 Long-term depression
    103734421 (Gnaq)
   04723 Retrograde endocannabinoid signaling
    103734421 (Gnaq)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103734421 (Gnaq)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103734421 (Gnaq)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734421 (Gnaq)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103734421 (Gnaq)
   05016 Huntington disease
    103734421 (Gnaq)
   05017 Spinocerebellar ataxia
    103734421 (Gnaq)
   05022 Pathways of neurodegeneration - multiple diseases
    103734421 (Gnaq)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103734421 (Gnaq)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103734421 (Gnaq)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103734421 (Gnaq)
   05163 Human cytomegalovirus infection
    103734421 (Gnaq)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103734421 (Gnaq)
   05142 Chagas disease
    103734421 (Gnaq)
   05143 African trypanosomiasis
    103734421 (Gnaq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103734421 (Gnaq)
   04031 GTP-binding proteins [BR:ngi04031]
    103734421 (Gnaq)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103734421 (Gnaq)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103734421 (Gnaq)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 103734421
NCBI-ProteinID: XP_008831567
LinkDB
Position
Un
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctgcgcagggacaagcgggacgcgcgccgggagctc
aagctgcttctgctagggacaggagagagtgggaagagtacttttatcaagcagatgagg
atcatccatgggtcagggtactctgatgaagataaaaggggctttaccaaactggtgtac
cagaacatcttcacagccatgcaggccatgatcagagctatggacacactcaagatccca
tacaagtatgaacacaataaggctcatgcacaattagttcgagaggttgacgtggaaaag
gtgtctgcttttgagaatccatatgtagatgccataaagagcctgtggaatgatcctgga
atccaggaatgttacgatagacgacgagaatatcagttatctgactctaccaaatactat
ctgaatgacttggaccgtgtagccgacccctcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccttttgacttacaaagtgtcata
ttcagaatggtggatgtggggggccaaaggtcagaaagaagaaaatggatacactgcttt
gagaatgtcacctccatcatgtttctagtagcgcttagcgagtacgatcaagttcttgtg
gagtctgacaatgagaaccgaatggaagaaagcaaagcactctttagaacaatcatcacc
tatccctggttccagaactcctcggttattctattcttaaacaagaaggatcttctagag
gagaaaatcatgtattcccacctagttgattacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaatccagacagt
gacaaaattatctactcccacttcacgtgtgccacagacacggagaacatccgcttcgtc
tttgctgcggtcaaggacaccatcctccagctgaacctgaaggagtacaatctggtctaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103737243
Entry
103737243         CDS       T03372                                 

Gene name
Gna11
Definition
(RefSeq) G protein subunit alpha 11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04540  Gap junction
ngi04725  Cholinergic synapse
ngi04730  Long-term depression
ngi04911  Insulin secretion
ngi04912  GnRH signaling pathway
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04928  Parathyroid hormone synthesis, secretion and action
ngi04929  GnRH secretion
ngi04934  Cushing syndrome
ngi04935  Growth hormone synthesis, secretion and action
ngi05142  Chagas disease
ngi05146  Amoebiasis
ngi05163  Human cytomegalovirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103737243 (Gna11)
   04022 cGMP-PKG signaling pathway
    103737243 (Gna11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103737243 (Gna11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103737243 (Gna11)
   04929 GnRH secretion
    103737243 (Gna11)
   04912 GnRH signaling pathway
    103737243 (Gna11)
   04935 Growth hormone synthesis, secretion and action
    103737243 (Gna11)
   04928 Parathyroid hormone synthesis, secretion and action
    103737243 (Gna11)
   04925 Aldosterone synthesis and secretion
    103737243 (Gna11)
   04927 Cortisol synthesis and secretion
    103737243 (Gna11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103737243 (Gna11)
  09156 Nervous system
   04725 Cholinergic synapse
    103737243 (Gna11)
   04730 Long-term depression
    103737243 (Gna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103737243 (Gna11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103737243 (Gna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103737243 (Gna11)
   05163 Human cytomegalovirus infection
    103737243 (Gna11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103737243 (Gna11)
   05142 Chagas disease
    103737243 (Gna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngi04147]
    103737243 (Gna11)
   04031 GTP-binding proteins [BR:ngi04031]
    103737243 (Gna11)
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103737243 (Gna11)
  Exosomal proteins of melanoma cells
   103737243 (Gna11)
GTP-binding proteins [BR:ngi04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103737243 (Gna11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 AAA_29
Other DBs
NCBI-GeneID: 103737243
NCBI-ProteinID: XP_008835233
LinkDB
Position
Un
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMDTLKILYKYEQNKANALLIREVDVEK
VTTFDHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKVLHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggaatccatgatggcgtgttgcctgagcgacgaggtgaaggagtcgaagcgc
atcaacgcggagatcgagaagcagctgcggcgggacaagcgcgatgcacggcgggagcta
aagctgctgctgctgggcactggcgagagcgggaaaagcacgttcatcaagcagatgcgc
atcatccatggcgccggctactcggaggaggacaagcgcggcttcaccaagttggtgtac
cagaacatcttcaccgctatgcaggccatgatccgcgctatggacacgctcaagatcctc
tacaagtatgagcagaacaaggccaacgcgcttctgatccgggaggtggatgtggaaaag
gtcacgacctttgatcaccagtatgtgaatgccatcaagaccctgtggagcgacccggga
gtgcaggagtgctacgaccgcaggcgcgagttccagctctcagactctgccaagtattat
ctgacagacgtggaccgcatcgccacggtgggctacctgcccacccagcaggatgtgctg
cgcgtgcgtgtacccaccaccggaatcattgagtacccatttgacctggaaaacatcatc
ttcaggatggtggacgtgggtggacagaggtcggagcgcaggaagtggatccactgcttc
gagaatgtcacatccatcatgttcctggtggctctgagtgaatatgaccaggtcctagtg
gagtcggacaatgagaaccgcatggaggagagcaaggcgctgttccgcaccatcatcacc
tacccctggttccaaaactcgtccgtcatcctcttccttaacaagaaggacctgttggag
gacaaggtcctgcactctcacctcgtggactatttccccgagtttgacgggccacagcgg
gatgcacaggccgcccgagaattcatcctgaagatgttcgtggacctgaaccctgacagc
gacaagatcatctactcccacttcacatgcgccaccgacacggagaacatccgctttgtg
tttgcagctgtcaaggatacaatccttcagctcaacctcaaggagtacaacttggtgtga

DBGET integrated database retrieval system