KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734567
Entry
103734567         CDS       T03372                                 

Gene name
Ldlr
Definition
(RefSeq) low density lipoprotein receptor
  KO
K12473  low-density lipoprotein receptor
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04144  Endocytosis
ngi04913  Ovarian steroidogenesis
ngi04925  Aldosterone synthesis and secretion
ngi04927  Cortisol synthesis and secretion
ngi04934  Cushing syndrome
ngi04976  Bile secretion
ngi04979  Cholesterol metabolism
ngi05145  Toxoplasmosis
ngi05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103734567 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103734567 (Ldlr)
   04925 Aldosterone synthesis and secretion
    103734567 (Ldlr)
   04927 Cortisol synthesis and secretion
    103734567 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    103734567 (Ldlr)
   04979 Cholesterol metabolism
    103734567 (Ldlr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103734567 (Ldlr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103734567 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103734567 (Ldlr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103734567 (Ldlr)
Membrane trafficking [BR:ngi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103734567 (Ldlr)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b cEGF FXa_inhibition SGL EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 103734567
NCBI-ProteinID: XP_008831779
LinkDB
Position
Un
AA seq 871 aa
MLSAERLRKENPMLRWTRTLLLAAAVAAAAAEATEEMCSRNEFRCQDGKCIARKWVCDGR
TECPDGSDEFPETCVSVTCKSEEFSCGGRVNRCISKSWQCDGQTDCENGSDEQDCAPKTC
SQDEFRCQDSRCISQKFLCDGDQDCLDGSDETSCPATTCGPAKFYCDSSCIPKLWVCDGD
PDCEDHSDEWPQHCGGHDTSARHGDSSPCSSLEFHCHSGECIHISWVCDGGADCRDKSDE
DNCAVATCRPDEFQCSDGACIHGSRQCDQEYDCKDMSDELGCINVTLCEGPDKFKCHSGE
CITMDKVCNSARDCRDWSDEPIKECKTNECLDNNGGCSHICNDLKISYQCLCPNGFRLVD
QHKCQDIDECQEPDTCSQLCVNLEGSYKCECEAGFQMDPRTQACKAIGSIAYLLFTNRHE
VRKMTLDRSEYTSLIPNLKSVVALDTDVATNRIYWSDLLQRKIYSAQIDGAPSLPYDTVI
GGNLEAPDGLAVDWIHGNIYWTDSVLGSVSVADTKGVKRRMLFQEEGSKPRAIVADPMHG
FMYWTDWGIPAKIKKGGLNGVDIYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSID
VNGGHRKTILEDEKQLAHPFSLAIYEDKVFWTDVMHEAIFSANRLTGSDVNLVAENLLSP
EDMVLFHNVTQPRGVNWCERTTLPNGGCQYLCLPAPQINPHSPKFTCVCPDGMVLAKDMR
SCLTEVTTVPTTQGISTIRPLVTTVAMGTERKDDQTTSSTSGPPANISRLSTAESVTMSH
QVLGDSPSRGNQEQPTGVGVLSIVLPLVLVVLLSFGTFLLWKNWRLRNVNSINFDNPVYQ
KTTEDEVHICRSQDGYTYPSRQMVSLEDDVA
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgctatcggcagagaggctaaggaaggagaacccgatgctgcgctggaccaggactctg
ctccttgcagctgctgttgctgcagctgctgctgaggctacagaagagatgtgtagcagg
aacgagttccggtgccaggacgggaaatgtattgccaggaagtgggtttgtgatggcaga
actgagtgcccagacggctctgacgagtttccagaaacatgcgtgtctgtcacctgcaaa
tctgaggaattcagctgtgggggtcgtgttaaccgctgtatttctaagtcctggcaatgt
gatggacagacagactgtgagaacggctcagatgaacaagactgtgctcccaagacatgc
tcccaagatgaattccgctgtcaagacagcaggtgcatttcccaaaagttcttatgtgat
ggggaccaggactgcctggatggctccgacgagacctcctgcccagctaccacctgcggc
cctgccaagttctactgcgactcctcctgcatccctaagctgtgggtctgtgatggcgac
ccggactgtgaggatcattcagatgagtggccacagcactgtggaggccatgacacatct
gcacgccatggggacagtagcccctgctcctcacttgagttccattgccatagtggagaa
tgcattcacatcagctgggtctgcgatggtggggctgactgcagggacaagtcggatgag
gacaattgcgctgtggccacctgccgccctgatgagttccagtgttcagatggtgcctgc
atccacggcagtcggcagtgtgaccaggaatacgactgcaaggacatgagtgatgagctt
ggctgcattaacgtgacgctgtgtgaggggccagacaaattcaagtgccacagtggtgaa
tgcatcaccatggacaaagtatgcaactctgcccgggactgccgggactggtcagacgaa
cccatcaaggagtgcaaaaccaatgaatgtttggacaacaatggaggatgttcccatatc
tgtaacgacctcaaaatcagctaccagtgcttgtgtcccaatgggttcaggctggtggac
cagcacaaatgccaagatattgatgagtgccaggagccggacacctgcagccagctgtgt
gtgaacttggagggcagctataagtgcgagtgtgaagcgggcttccagatggacccccgc
acccaggcctgcaaggccataggttccattgcctacctgctgttcaccaaccgccatgag
gtacgaaagatgaccctggaccgtagtgagtacaccagcctcatccccaacttgaagagt
gtggttgccttggacactgatgtggccaccaacagaatctactggtcagatctgttgcaa
aggaagatctacagcgcccagatagatggagcccccagtttaccctatgacacagttatc
ggtgggaacctcgaggctccagatgggctggcagtggactggatccatggaaacatctac
tggactgattctgtcctgggcagtgtgtctgtggctgacaccaagggtgtgaagaggagg
atgctgttccaagaggaaggttccaagcccagggccattgtggccgaccctatgcatggc
ttcatgtactggacagattgggggatacctgctaagatcaaaaaagggggtctgaatggt
gtggatatctactcgttggtgaccgaagacatccagtggccaaatggcatcacgctggac
ctttctagtggccgcctctattgggtggactccaaactccattccatctccagcattgat
gtcaatgggggacatcggaagaccattttagaggatgagaagcagctggcccaccccttc
tccttggccatctatgaggacaaagtgttttggaccgatgtcatgcatgaagccattttc
agtgccaatcgcctcacgggttcagatgttaatttggtggctgaaaacctgctgtccccg
gaggacatggtcctgttccacaatgtcacacagccaagaggagtgaactggtgtgagaga
acaaccctccccaatggtggctgccagtacctgtgtctaccagccccacagatcaaccca
cactcccccaagttcacctgtgtgtgcccagatggtatggtcctggccaaggacatgagg
agctgcctcacagaagtcaccactgtaccaaccacccaggggatatccaccatcaggccc
ctggtcaccactgtggctatggggacagaacgcaaggatgaccagacaacttctagcacc
tctggacctcctgccaacatctccaggctcagcacagcggagtcagtgacaatgtcccat
caagtcctgggtgacagtcctagcagagggaaccaggagcagccaacgggagtgggagtt
ctgtctattgtcctccccctggtgctggtcgtgctcctgagcttcggaaccttcctgctc
tggaagaactggcggctgaggaacgtcaacagcatcaactttgacaatcctgtgtaccag
aagaccacagaggatgaggtccacatttgccgcagtcaggatggctacacctacccctcg
agacagatggtcagcctggaggatgatgtggcgtga

DBGET integrated database retrieval system