KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734793Help
Entry
103734793         CDS       T03372                                 

Gene name
Sod2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04068  FoxO signaling pathway
ngi04146  Peroxisome
ngi04211  Longevity regulating pathway
ngi04213  Longevity regulating pathway - multiple species
ngi05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103734793 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103734793 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    103734793 (Sod2)
   04213 Longevity regulating pathway - multiple species
    103734793 (Sod2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    103734793 (Sod2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103734793 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103734793
NCBI-ProteinID: XP_008832081
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACGAGGRLAPAVGVLGSRQKHSLPDLPYDYGALEPHINGQIMQLHHSKHHATYVN
NLNATEEKYREALAKGDVTAQVALQPALKFNGGGHLNHAIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQVAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVAERYSACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggcggcgtgcggtgcgggcgggaggctggccccggcggtgggcgtcctg
gggtcccggcagaagcacagcctccccgacctgccttacgactatggcgcgctggagccg
cacatcaacgggcagatcatgcagctgcaccacagcaagcaccacgccacctacgtgaac
aacctgaacgccaccgaggagaagtaccgcgaggcgctggccaagggagatgttacggct
caggtagctcttcagccggcgttgaagttcaatggtggaggacatcttaatcatgccatt
ttctggacgaacttgagccctaatggtggtggagaacccaaaggagagttgctggaagct
atcaaacgtgactttgggtcttttgagaagtttaaggagaagctgacagctgtgtctgtt
ggcgtccaaggctcaggctggggctggcttggcttcaataaggagcagggacgcttacag
gttgctgcctgctctaatcaggacccattgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcatgcctattaccttcagtataaaaacgtcagacctgattac
ctgaaagctatttggaatgtgatcaactgggagaacgtagctgaaagatactccgcttgc
aagaagtaa

DBGET integrated database retrieval system