KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734864
Entry
103734864         CDS       T03372                                 

Gene name
Cdh1
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04015  Rap1 signaling pathway
ngi04371  Apelin signaling pathway
ngi04390  Hippo signaling pathway
ngi04514  Cell adhesion molecules
ngi04520  Adherens junction
ngi05100  Bacterial invasion of epithelial cells
ngi05200  Pathways in cancer
ngi05213  Endometrial cancer
ngi05216  Thyroid cancer
ngi05218  Melanoma
ngi05219  Bladder cancer
ngi05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103734864 (Cdh1)
   04390 Hippo signaling pathway
    103734864 (Cdh1)
   04371 Apelin signaling pathway
    103734864 (Cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103734864 (Cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103734864 (Cdh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103734864 (Cdh1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103734864 (Cdh1)
   05216 Thyroid cancer
    103734864 (Cdh1)
   05218 Melanoma
    103734864 (Cdh1)
   05219 Bladder cancer
    103734864 (Cdh1)
   05213 Endometrial cancer
    103734864 (Cdh1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103734864 (Cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ngi03036]
    103734864 (Cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ngi04515]
    103734864 (Cdh1)
   04090 CD molecules [BR:ngi04090]
    103734864 (Cdh1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103734864 (Cdh1)
Cell adhesion molecules [BR:ngi04515]
 Cadherins
  Major cadherins
   103734864 (Cdh1)
CD molecules [BR:ngi04090]
 Proteins
  103734864 (Cdh1)
SSDB
Motif
Pfam: Cadherin Cadherin_C RET_CLD1 Cadherin_2 Big_9
Other DBs
NCBI-GeneID: 103734864
NCBI-ProteinID: XP_017653858
LinkDB
Position
Un
AA seq 754 aa
MTLSLDPSQKCSCFPAPTRVXRRQKRDWVIPPISCPENEKGPFPKDLVQIKSNRDKETQV
YYSITGQGADKPPVGVFTIERETGWLRVTEPLDREAIPKYILYSHAVSSNGNAVEEPMEI
VIAVTDQNDNKPEFIKKVFEGSVMEGALPGTSVMQVSATDADDDVNTYNAAIAYTILSQD
PELPHKNMFTVNRDTGVISVVTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVTDI
NDNAPIFNPTMYQGQVPENEANAYITTLKVTDDDTPHTPAWEAVYTIINDPEQQFIVTTD
PATNDGILKTTKGLDFEAKQQYILHVTVGNVAPFEGALVTSTATVTVDVMDVNEAPIFVP
AEKRVEVPEDFSVGLEITSYTAREPDTFMDQKITYRIWRDTANWLEINPDTGAIFTRAEM
DREDFEHVKNSTYTALIIATDNGSPIATGTGTLLLVLSDVNDNAPIPEPRNVHFCQRNPQ
PQVINIIDPDLPPNTSPFTAELTHGASVNWTIEYSDPAQESLLLKPRKTLELGDYKINLR
LMDNQNKDQVTTLDVIVCDCEGAVNNCMRANYVEAGLQVPAILGILGGILALLILILLLL
LFLRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVA
PTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSL
NSSESDRDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgactctgtctctggatcccagccagaagtgctcatgtttcccagctcccaccagagtt
nccagaagacagaagagagactgggtcatccctcccatcagctgcccagaaaatgaaaag
ggcccatttcctaaagacctggttcagatcaaatccaacagggacaaagaaacccaggtt
tactacagcatcactggccaaggagctgacaaaccccctgttggtgtctttactattgaa
agagaaacagggtggctgagggtgacggaacctctggatagagaagctattcctaagtat
atcctgtattctcatgctgtgtcatctaatgggaacgctgtggaggagcccatggagatt
gtgatcgcggtgacagatcagaatgacaacaagcccgagttcatcaagaaggtctttgaa
gggtctgtcatggaaggtgctcttccaggaacctctgtgatgcaggtctcagccactgat
gcagatgacgacgtaaacacctacaatgctgccatcgcctacaccatcctcagccaagat
cctgagctgcctcacaaaaatatgttcactgtcaatagggacacaggggtcatcagtgtg
gtcacctccggactggaccgagagagttatcccacgtataccctggtggttcaagctgct
gaccttcaaggcgaaggcttaagcactacagcaaaagctgtaatcacagttactgacatc
aacgacaacgctcccatcttcaacccaaccatgtaccagggtcaggtgcctgagaatgag
gctaatgcctacatcactacactcaaagtgactgatgatgacactccccacactccagca
tgggaggccgtgtacaccatcataaatgatcctgaacaacaatttattgtcaccacagac
cctgcaaccaatgatggcattctgaaaacaaccaagggcttggattttgaggccaagcaa
cagtatattctacacgtgacagtggggaacgtggccccctttgagggggctcttgtcaca
tccacagccactgtcactgtggacgtgatggacgtgaatgaggcacccatctttgttcct
gctgaaaagagagtagaagtacctgaggacttttccgtgggcctggagatcacgtcctac
acagcccgggagccagacaccttcatggatcagaagatcacgtatcggatttggagagac
actgccaactggctggagattaatccagataccggtgccatttttactcgggctgagatg
gacagagaagactttgagcatgtgaagaacagcacatacacagccctcatcattgccaca
gacaatggctctccgattgccacaggcacaggaacccttctcctggttctatctgatgtg
aatgacaatgctcccatcccagaacctcgaaatgtacacttctgccagaggaatccacag
cctcaagtcatcaacattattgatccagacctgccccccaacacctcccccttcacagcc
gaactaacccatggggccagcgtcaactggaccatagagtacagtgacccagcccaagag
tctctcctcttgaagccaagaaagaccttagagttgggtgactacaaaatcaacctcagg
ctcatggataaccagaacaaagaccaggtgaccaccttggacgtcattgtgtgcgactgc
gaaggggccgtcaacaactgtatgagggcgaattatgtggaagcgggattacaagttcct
gccatcctggggattcttggaggaattctggctttgctgatcctcatcctgctactcctg
ctgtttctgcgaaggagaggcgtggtcaaagagccgctactgcccccagaggacgacacc
cgggacaacgtgtattactatgatgaagaaggaggtggagaagaagaccaggactttgac
ttgagccagctgcacaggggcctggacgctcgacctgaagtgactcgcaatgacgtggct
cccaccctcatgagtgtgccccagtatcgtccccgccctgccaatcctgatgaaattgga
aactttattgatgaaaacctgaaggcagcggacagcgaccccacagcgcctccttatgac
tcgctgctggtgtttgactatgagggaagtggttctgaagctgctagcctgagctctctg
aactcctcagagtcagaccgggaccaggactacgactacctgaatgagtggggcaatcgc
ttcaagaagctggctgacatgtacggcggtggggaggacgactag

DBGET integrated database retrieval system