KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734978
Entry
103734978         CDS       T03372                                 

Gene name
Nfatc3
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04625  C-type lectin receptor signaling pathway
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04921  Oxytocin signaling pathway
ngi05135  Yersinia infection
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103734978 (Nfatc3)
   04310 Wnt signaling pathway
    103734978 (Nfatc3)
   04022 cGMP-PKG signaling pathway
    103734978 (Nfatc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103734978 (Nfatc3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103734978 (Nfatc3)
   04660 T cell receptor signaling pathway
    103734978 (Nfatc3)
   04658 Th1 and Th2 cell differentiation
    103734978 (Nfatc3)
   04659 Th17 cell differentiation
    103734978 (Nfatc3)
   04662 B cell receptor signaling pathway
    103734978 (Nfatc3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103734978 (Nfatc3)
  09158 Development and regeneration
   04360 Axon guidance
    103734978 (Nfatc3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103734978 (Nfatc3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103734978 (Nfatc3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103734978 (Nfatc3)
   05170 Human immunodeficiency virus 1 infection
    103734978 (Nfatc3)
   05161 Hepatitis B
    103734978 (Nfatc3)
   05163 Human cytomegalovirus infection
    103734978 (Nfatc3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103734978 (Nfatc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103734978 (Nfatc3)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103734978 (Nfatc3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 103734978
NCBI-ProteinID: XP_008832287
LinkDB
Position
Un
AA seq 1073 aa
MTTANCGAHDELDFKLVFGEDGAAPESQGSRPADLEPDDCASIYIFNVDPPPSSLNSSLG
LPHHGLPSHSSVLSPSFQLQGHKNYEETGDIPESKYSPLGGPKPFECPSIQITSISPNCH
QETDVHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASS
CESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEDSWHQQYGLGHSLSPRQSP
CHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHSP
RGSITEDTWLTASVHSGAGVGPALFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDD
QGSLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLD
WPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMF
IGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGIL
KLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASTPVECSQRSAQELPH
IEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEAEGKIIREKCQGAHIV
LEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEQREDVDLSSVPPLPVP
HPAQTQRPSSDTGHPHDSVLSVQRSLICPIQPSYASMVTSSHLPQLQCRDEGAGKEQPIM
PSSVVHQPFQVTSASPMGSSYQPMQNNVYSGPTCLPINAASSQEFDPVLFQQDAALPSLL
NLSCQPLSSVAFHSSNSGTTGHLLAHSPHSVQTPPHLQSMGYHCSNTGQRSLSSPVADQV
TGQPPSQLQPITYCPSHPGSATTASPATAHPLASSTLSGPSSPQLQSMPYQSPGSGTASS
PSPTSRMHSGQHSTQAQSIGQGGLSVPSSLVCHSLCDPASFSPDGGAVNIKPEPEDREPN
FTTIGLQDITLDDVNEIIGRDMSQISVSQGPEVSREVPLPDPEPPDLGRSDEL
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtcttcggcgag
gacggggcggcgccggagtcccagggctcgcggcctgcagatcttgagccagatgattgt
gcatccatttacatctttaatgtagatccacctccatcttctttaaactcatcacttggc
ttaccacatcatggattgccgtctcactcttctgttttgtcaccatcatttcagctccaa
ggtcacaaaaactatgaagaaactggtgatattcctgaatccaaatatagcccattaggt
ggtcccaaaccctttgagtgcccaagtattcaaattacatccatctctcctaactgtcat
caagaaacagatgtccatgaagatgatctacatataaatgatccagaaagggaatatttg
gaaaggccttctagagatcatctctaccttcctcttgagccttcctaccgagagtcttcc
cttagtcctagtcctgccagcagcatttcttctaggagctggttctcagatgcatcgtct
tgtgaatctctctcacatatttatgatgatgtggactcagagctgaatgaagctgctgct
cgatttactcttggatctcctctgacttctccaggtggctctccaggaggttgccctgga
gaagattcgtggcatcaacagtatggacttggacactctttgtcacctaggcaatctcct
tgccactctcccagatccagtatcactgatgagaattggctgagccccaggccagcctca
ggaccctcatcgaggcccacttccccctgtgggaaacgacggcactccagtgctgaagtg
tgttatgctggttccctttcaccccatcactcacctgttccttctcctggtcactcccct
agaggaagtataacagaagatacctggcttactgcttctgttcacagtggagcaggtgtt
ggccctgcactttttccatttcagtactgtgtggaaactgatatccctttgaaaacaagg
aagacttctgaagatcaagctgccatactaccaggaaaattagaactctgttcagatgat
caagggagcttatcaccatcccgggagacttcaatagatgatggccttggatctcagtat
cctttaaagaaagattcatctggtgaccaatttctttcagttccttcaccctttacctgg
agcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccattagac
tggcctttaccaactcactttggacaatgtgaattgaaaatagaagtgcaacctaaaact
catcatcgtgcccattatgaaactgaaggtagtcgaggggcagtaaaagcctctactggt
ggacatcctgttgtgaagctcctgggctataatgaaaaaccaataaatctacagatgttt
attggaacagcagatgatcggtatttgcgacctcacgcattttaccaggtgcatcgaatc
actggaaagacagttgctactgcaagtcaagagataataattgccagtacaaaagttctg
gaaattccacttcttcctgaaaataatatgtcagccagcattgactgtgcaggtattttg
aaactccgaaattcagatatagaacttcgaaaaggagaaaccgatattggcagaaagaat
actagagtacgacttgtgttccgtgtacacatcccacagcccaatggaaaagtcctttct
ctgcagatagcttctacacctgttgaatgctctcagcgatctgctcaagaacttcctcat
attgagaagtacagtatcaacagctgttctgtaaatggaggccatgaaatgattgtgact
ggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatggaaga
cctcattgggaagcagaagggaaaataattcgggaaaaatgtcaaggggctcacattgtt
cttgaagttcctccctatcataacccagcagttacagctgcagtgcaggtgcacttttat
ctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagttttg
atgaagcaagaacaaagagaagatgttgatttgtcttcagttccacctttacctgtgcct
catcctgcccagacccagaggccttcttcagatacagggcacccacatgacagtgtactg
tcagtacagagaagcttgatttgtcccatccagccatcatatgcatccatggtaacctct
tcccatctgccacaattgcagtgtagggatgagggtgctggtaaagaacagcccataatg
ccatcatcagttgtgcaccagccttttcaagttacatcagcatctcctatggggtcttcc
tatcagcctatgcaaaataatgtgtacagtggaccaacttgtcttcctattaatgctgcc
tctagtcaagaatttgatccagttttgtttcagcaggatgcagctcttcctagtttatta
aaccttagctgtcaaccactgtcatcagtagcatttcattcttcaaattcaggcacaaca
ggacatctcttagcacattcacctcattctgtgcaaaccccacctcatctgcagtcaatg
ggataccattgttcaaacacaggacaaagatctctttcttctccagtggcagaccaggtt
acaggtcagccgccttctcagttacagcctattacatattgtccttcacatccgggatct
gctacaacagcttccccagcaaccgctcatcccctggctagttcaactctttctgggcca
tcgtcccctcagctacagtctatgccttaccaatctcctggctcaggaactgcctcatca
ccatctccaacctccagaatgcattctggacagcattcaactcaagcacaaagtataggc
cagggaggtctttctgtaccttcatccttagtatgtcacagtttgtgtgatccagcatca
ttttcgcctgatggcggagctgtgaacattaaacctgaaccggaagatcgggaacctaac
tttactaccattggtctacaggacatcactttagatgatgtgaacgagataattgggaga
gatatgtcccagatttctgtttcccaaggccctgaggtgagcagagaggttcctctccca
gatcctgagcctccggatttaggaagatctgatgagctgtaa

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735763
Entry
103735763         CDS       T03372                                 

Gene name
Nfatc2
Definition
(RefSeq) nuclear factor of activated T-cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04370  VEGF signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04921  Oxytocin signaling pathway
ngi05135  Yersinia infection
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103735763 (Nfatc2)
   04370 VEGF signaling pathway
    103735763 (Nfatc2)
   04022 cGMP-PKG signaling pathway
    103735763 (Nfatc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103735763 (Nfatc2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103735763 (Nfatc2)
   04650 Natural killer cell mediated cytotoxicity
    103735763 (Nfatc2)
   04660 T cell receptor signaling pathway
    103735763 (Nfatc2)
   04658 Th1 and Th2 cell differentiation
    103735763 (Nfatc2)
   04659 Th17 cell differentiation
    103735763 (Nfatc2)
   04662 B cell receptor signaling pathway
    103735763 (Nfatc2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103735763 (Nfatc2)
  09158 Development and regeneration
   04360 Axon guidance
    103735763 (Nfatc2)
   04380 Osteoclast differentiation
    103735763 (Nfatc2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103735763 (Nfatc2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103735763 (Nfatc2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103735763 (Nfatc2)
   05170 Human immunodeficiency virus 1 infection
    103735763 (Nfatc2)
   05161 Hepatitis B
    103735763 (Nfatc2)
   05163 Human cytomegalovirus infection
    103735763 (Nfatc2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103735763 (Nfatc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103735763 (Nfatc2)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103735763 (Nfatc2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 103735763
NCBI-ProteinID: XP_008833370
LinkDB
Position
Un
AA seq 931 aa
MDALEPQPDPDGGDGPGQEPGGSPQEELDFSILFDYDYLNPIEEEPSTHKAISSPSGLAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRIGTQNFLSPAKPTGASGPSPRIEITPSYE
LMQAGGALRGRDASLVPEPPALALAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASF
ISDTFSPYTSPCVSPNNTAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDICLGRHSP
VPRPASRSSSPGAKRRHSCSEASVTPVPGASPQRSRSPSPQPSPRVAAQDDGIPAGYPPT
AGSAVLMDALNSLATDSPCGIPSKIWKTSPDPTPVSAAPSKAGLPRHIYPAAVEFLGPCE
QDERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSNQSGSYELRIEVQP
KPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQV
HRITGKTVTTTSYEKIVGNTKILEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIG
RKNTRVRLVFRVHVPEPSGRIVSLQTASNPIECSQRSAHELPMVERQDVDSCLVYGGQQM
ILTGQNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNRHIRIPVKV
NFYVINGKRKRSQPQHFTYHPVPAIKTEPSDECDPSLLCSPAHGGLGSQPYYPQHPMLAE
SPSCLVATMAPCQQFRSGLSSPDARYQQQNPAAALYQRSKSLSPGLLGYQQPALLAAPLG
LADAHRSVLVHAGSQGQGQGSTLPHTSPASQQASPVIHYSPTNQQLRSGGHQEFQHIMYC
DNFGPSSTRPGPTPISQGQRLSPGSYPTVIQQQNAPTQRAAKNGPPVSDQKEALPAGVTV
KQEQNLDQTYLDDVNEIIRKEFSGPPPRNET
NT seq 2796 nt   +upstreamnt  +downstreamnt
atggatgccttggagccgcagcccgaccccgacggcggggacggcccaggccaggagcct
gggggcagcccccaagaagagttggacttctccatcctcttcgattatgactatttgaac
cccatcgaagaagaaccgagcacacataaggccatcagctcaccctccggacttgcatac
cccgatgatgtcctggactatggcctcaagccatacagccccctcgccagtctttctggc
gagccccccggccgctttggagagccggataggatagggacccagaactttctgagcccc
gccaagccaacaggggcctcaggcccaagccctcggatcgagatcactccatcctatgaa
ctgatgcaggcagggggggccctccgtgggagagatgccagcctggtgcctgagccgccg
gccctggccctagccggggtggccgccagcccgaggttcacgctgcccgtgccaggcttc
gagggctaccgcgagcccctctgcttgagccccgctagcagtggctcctctgccagcttc
atttccgacaccttctccccctacacttcgccctgcgtctcgcccaataacaccgcaggg
ccggacgacctgtgtccccagtttcaaaacattcctgctcattattcccccagaacgtcg
ccaataatgtcacctcgaaccagcctcgccgaggacatctgcctgggccgccactcgccc
gtgccccgtccagcctcccgctcctcctcacccggtgccaagcggaggcattcctgctcc
gaggcctcggttacccctgtgcccggagcctcaccccagcgctcccggagcccctctccg
cagccctcgccgcgcgtggcagcccaggacgacggcatccccgccgggtacccccccacg
gctggctctgcggttctgatggatgccctcaacagcctcgccacggactcgccctgcggg
atcccctctaagatctggaagaccagccccgatcccacccccgtgtctgccgccccatcc
aaggccggcctgccccgccacatctaccctgcagccgtggagttcctggggccctgcgag
caggacgagaggaggaattcagctccggagtccatcttgctggtgccccccacctggccc
aagcagctggtccctgccattcccatctgcagcatccctgtgaccgcatccctccctcca
cttgagtggccactctccaatcagtccggctcctatgaactgcggatcgaggtccagccc
aagccccatcaccgggcccactatgagacggagggcagccgaggtgctgtcaaagcccca
acgggaggtcaccctgtggtgcagctgcatggttacatggagaacaagcccctgggactt
caaatcttcattgggacggccgacgagaggatcctcaagccgcatgccttctaccaggta
cacaggatcacaggcaaaaccgtcaccactaccagctacgagaagattgtaggcaacacc
aagatcctggagattccactggaaccgaagaacaacatgcgggccaccatcgactgcgca
ggcatcctgaagctacgaaatgctgacattgagcttcgaaaaggggagacggacatcggc
agaaagaacacccgggtgcggctggtattccgcgtccacgtcccagagcccagtggccgc
atcgtctctctgcagacagcatccaaccccattgagtgctcccagcgctccgcccacgag
ctgcccatggtggagagacaggacgtggatagctgcctggtctacgggggccagcagatg
atcctcaccggccagaactttacagctgagtccaaggtcgtgttcacagagaagaccaca
gatgggcagcagatttgggagatggaagccacggtggataaagacaagagccagcctaac
atgctttttgttgagatccctgagtatcggaacaggcatatccgtatacccgtaaaagta
aacttctacgtcatcaatgggaaaagaaaacgaagccagccacagcactttacctaccac
ccagtcccagccatcaagacggagccaagtgatgagtgtgacccctctttgctctgcagc
cctgctcatggaggcctagggagccagccctattatccacagcacccgatgctggctgag
tccccctcctgccttgtggccaccatggccccctgccagcagttccgctctgggctgtca
tcccccgatgcccgttaccagcagcagaaccctgcagccgccctctaccagaggagcaag
agcctgagcccaggcctgctgggctaccagcagccagccctgctggcagcacccctgggc
ttggctgatgcccaccgatctgtgctggtacatgccggctcccagggccagggtcaaggc
tcaaccctgccgcacacgtccccagccagtcagcaggcttcacccgtgatccactactca
cccaccaaccagcagcttcgcagtgggggccaccaagagttccagcatatcatgtactgt
gacaacttcggtcccagctccaccaggcctggcccaacccccatcagccaaggccagagg
ctgagcccaggctcctaccccacagtcatccaacaacagaatgccccgacccaaagagct
gccaaaaacggacccccggtcagcgaccagaaggaagccctacccgctggagtgacagtc
aaacaggaacagaatctggaccagacctacctggatgatgttaatgaaatcattagaaag
gagttttcaggacctcctcccagaaatgaaacatag

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103739410
Entry
103739410         CDS       T03372                                 

Gene name
Nfatc4
Definition
(RefSeq) nuclear factor of activated T-cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04022  cGMP-PKG signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04360  Axon guidance
ngi04625  C-type lectin receptor signaling pathway
ngi04921  Oxytocin signaling pathway
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103739410 (Nfatc4)
   04022 cGMP-PKG signaling pathway
    103739410 (Nfatc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103739410 (Nfatc4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103739410 (Nfatc4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103739410 (Nfatc4)
  09158 Development and regeneration
   04360 Axon guidance
    103739410 (Nfatc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103739410 (Nfatc4)
   05170 Human immunodeficiency virus 1 infection
    103739410 (Nfatc4)
   05161 Hepatitis B
    103739410 (Nfatc4)
   05163 Human cytomegalovirus infection
    103739410 (Nfatc4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103739410 (Nfatc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103739410 (Nfatc4)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103739410 (Nfatc4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 103739410
NCBI-ProteinID: XP_008838012
LinkDB
Position
Un
AA seq 897 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGSGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGTGGGRVLECPSIRITS
ISPTPDPPAPLDDTPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RAPEDSWLLLSAPGPAPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYVGAPPTESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPSGAEE
GAAPSGGLRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEAAVNRLQSSEVTLTLTIPEYSNKRVSR
PVQVYFYVSNGRRKRSPAQSFKFLPVIFKEEPLPDSSLRGFPSTSGPPFGTDMDFSPPRP
PYPSYPHEDPAYETPYLSEGFGYSTPPLYPQTGPPPSYRSGLRMFPETGGARPPAVSFLP
RPFPGDPYGRRGSSFPLGLPFSPPAPFRPPLPSSPPLEGPFPPQNAVHPLPAEGYNEVGP
GYAPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPPA
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgggggctgcgagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcggggggttctggggaagagctggactcagaggatgcc
ccgccatgctgccgtttggccctgggggaaccccctccctatggtgctgcccctattggt
attccccgaccaccaccccctcggccaggcatgcactcaccaccgccccgccccgccccc
tcacctggcacctgggagagccagccggcccggtcggtgaggctggggggcccaggaggg
ggtgctgggggtaccgggggcggtcgcgttctagagtgtcccagcatccgaatcacctcc
atctctcccacgcctgacccgccggccccgttagacgacactcctgatgcctggggggac
ggctctcctagagattaccccccaccagaaggctttgggggctaccgagaggcaggaggt
cagggtgggggcgccttcttcagccccagccctggcagcagcagcctgtcttcatggagt
ttcttctcggatgcctctgacgaggcagctctatacgcagcctgcgacgaggtggagtct
gagctaaatgaagctgcgtcccgctttggcttgggttctccactgccgtcgccccgggct
tctcctaggccttggaccccggaggacccctggagcctgtatggtccaagccctggaggc
cgagcgccggaggatagctggctactcctcagcgctcctgggccggccccagcctcgccg
cggcctgcctctccctgtggcaagcggcgctattccagctccggaaccccttcctcggcc
tccccagctctgtcccgccggggcagcctgggggaagaagggccggagccccctccacca
cccccattgcctctggcccgggaccctggctcccctggcccttttgactatgtgggtgcc
ccaccaaccgagagcatcccccaaaagacccggaggacttctagtgagcaggcagtggcc
ctgcctcggtctgaggaacctgccccgtgcaatgggaagctgccatcgggagcagaggag
ggtgctgctccttccgggggtctgcggaaagaggtggcgggtatggactacctggcggtg
ccatctcctcttgcttggtccaaggcccggattgggggacacagtcccattttcaggacc
tctgccctacctccccttgactggcctttgcccagccagtatgagcagctggagctgagg
atcgaggtgcagcctagagcccaccaccgagcccactatgagactgagggtagccgagga
gcggtcaaagctgctcctggaggtcaccctgtggtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcattggcactgcagatgaaaggaacctgcgtccgcatgcc
ttctatcaggtgcaccgtatcaccggcaaaatggtggccacggccagctatgaagctgta
gtcagtggaaccaaagtgttggagatgaccttgcttcctgagaacaacatggctgccaac
attgactgtgctggaatcctgaagcttcgaaactcagacattgagctgcggaagggtgag
acggacatcgggcgcaaaaacacgcgtgtgcggctggtgttccgtgtacatgtgcctcag
ggcggcgggaaggtcgtctctgtgcaggcagcttcagtgcccatcgagtgctcccagcgc
tcagcccaggagctgccccaggtggaggcctacagccccagcgcctgctctgtgagagga
ggagaggaactagtgctgactggctccaacttcctgccagactctaaagtggtgttcatt
gagaggggccctgatggaaagctacaatgggaggaggaggctgcggtgaaccggctgcag
agcagtgaggtgacactgactctgaccatccctgagtacagcaacaagcgggtgtcccgg
ccagtccaagtctacttttatgtctccaatggacgaaggaagcgtagtcctgcccaaagt
ttcaagttcctgcctgtgatcttcaaggaggagccccttccagactcatctctccggggc
ttcccttccacatcgggtcccccctttggcactgacatggacttctcaccacccaggccc
ccttacccctcctacccccatgaagatcctgcctatgaaacgccatacctgtcagaaggc
tttggttatagcacaccccctctgtacccccagacgggacccccaccatcctacagatca
ggcctacggatgttccctgagactggaggtgcccgcccacctgcagtctccttccttccc
cgccccttccctggcgatccttatggaagacggggctcctctttccccctggggcttcca
ttctcccctccagccccctttcggcctccactgccttcctccccaccacttgaaggcccc
ttccctccccagaatgctgttcaccccctacctgctgagggctacaatgaggtggggcca
ggctatgcccctggggagggggctccggagcaggagaaatccaggggtggctacagcagc
ggcttcagagacagtgtccctatccagggtatcacgttggaggaagtgagtgagatcatt
ggccgagacctgagtggcttccctgcacctcctggagaagagcctcctgcttga

KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103748128
Entry
103748128         CDS       T03372                                 

Gene name
Nfatc1
Definition
(RefSeq) nuclear factor of activated T-cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04024  cAMP signaling pathway
ngi04218  Cellular senescence
ngi04310  Wnt signaling pathway
ngi04380  Osteoclast differentiation
ngi04625  C-type lectin receptor signaling pathway
ngi04650  Natural killer cell mediated cytotoxicity
ngi04658  Th1 and Th2 cell differentiation
ngi04659  Th17 cell differentiation
ngi04660  T cell receptor signaling pathway
ngi04662  B cell receptor signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05135  Yersinia infection
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05167  Kaposi sarcoma-associated herpesvirus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ngi05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103748128 (Nfatc1)
   04310 Wnt signaling pathway
    103748128 (Nfatc1)
   04024 cAMP signaling pathway
    103748128 (Nfatc1)
   04022 cGMP-PKG signaling pathway
    103748128 (Nfatc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103748128 (Nfatc1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103748128 (Nfatc1)
   04650 Natural killer cell mediated cytotoxicity
    103748128 (Nfatc1)
   04660 T cell receptor signaling pathway
    103748128 (Nfatc1)
   04658 Th1 and Th2 cell differentiation
    103748128 (Nfatc1)
   04659 Th17 cell differentiation
    103748128 (Nfatc1)
   04662 B cell receptor signaling pathway
    103748128 (Nfatc1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103748128 (Nfatc1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103748128 (Nfatc1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103748128 (Nfatc1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103748128 (Nfatc1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103748128 (Nfatc1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103748128 (Nfatc1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103748128 (Nfatc1)
   05170 Human immunodeficiency virus 1 infection
    103748128 (Nfatc1)
   05161 Hepatitis B
    103748128 (Nfatc1)
   05163 Human cytomegalovirus infection
    103748128 (Nfatc1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103748128 (Nfatc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ngi03000]
    103748128 (Nfatc1)
Transcription factors [BR:ngi03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    103748128 (Nfatc1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 103748128
NCBI-ProteinID: XP_017658096
LinkDB
Position
Un
AA seq 971 aa
MRSRQRIKQEALEWPDFRILLEAAPGSGGREAMDCSVGPSGLKPGLGFTDLLSMGFLLPG
LMSSLLSLLPEHYNYASPSISSALPLPTAHASLPAPCHDLQTSTPGISAVPSANHPPSYG
RAVDSGPSGYFLSSGNTRPNGAPALESPRIEITSYLGLHHSSSQFFHDVEVEDVLPSCKR
SPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCV
SPKTTDPEEGFPRGLGACHLLGSPRHSPSTSPRASVTEESWLGARSSRPTSPCNKRKYSL
NGRQTSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSSLDLSDG
VPIKSRKTALEHVPSVALKVEPAGEDLGTTPPTSDFPPEEFTFQHLRKGAFCEQYLSVPQ
APYQWAKPKTLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAV
KASAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAIL
SNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQP
NGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVVFVE
KAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVQVSFYVCNGKRKRSQYQHF
TYLPANVPIIKTEPTDDFEPALTCGPMSQGLSSFPRPYYSQQLTMPPDPSSCLVAGFSPC
SQRSTLMSTSPNTSPKLQDLSSAAYTKGLTSPGHSGHLGLQPPAAEAPAMQEVPRPMAMQ
PSSPEQPPPALLQPQVSPHLSSSCSLGCQQALCPNSPSSPLPSAAHEPTCLQSSAHSPTM
GHQQHQLQKVQRNESPAAGPLSLPEVRENSDHNLAPIPVAIKREPEELDQLYLDDVNEII
RNDLSSANPHS
NT seq 2916 nt   +upstreamnt  +downstreamnt
atgaggtctagacagcgaatcaagcaggaggccttggagtggcctgatttcaggatactt
ttagaggctgctcctgggtctggaggccgggaggctatggactgcagcgtgggaccctcg
gggttgaagccaggtcttgggttcactgacctcctgagtatgggcttcttgctccctggc
ctcatgtcatctcttctctctctccttccagaacactacaattatgcatcccccagcatc
agctcagctctgccccttcccacagcacatgcttccttaccagcaccgtgccatgacctc
cagacgtccactccaggcatctcagctgttccttcagcaaatcaccctccaagttatggc
agggctgtggacagtgggccctcagggtactttctgtcatctggcaacactcggcccaat
ggggccccagctctggaaagccctcgaatagagattacctcttacctgggcctgcaccac
agcagcagccagtttttccatgatgtggaggtggaagacgtgcttcctagttgcaagcgg
tcaccatccacagctaccttgcacctgcccagcctggaggcctacagagacccctcctgc
ctgagcccagccagcagcctatcctccaggagctgcaattccgaggcctcctcttacgag
tctaattattcatacccatatgcatccccccagacttccccatggcagtcaccctgtgtg
tcccccaagaccacggacccagaggagggctttccccgaggcctgggtgcctgccacctg
ctgggctccccaaggcactccccatccacctctccccgtgcgagtgtcacagaggagagc
tggctgggggcccgcagctcccggcccacatccccctgcaacaagcgcaagtacagcctc
aatgggaggcagacctcctgctcaccccatcactcaccgacaccatccccccacggctcc
cctcgggtcagtgtaaccgaagacacctggcttggcaacaccacccagtacaccagctca
gccatcgtggcagccatcaatgccctgaccaccgacagcagcctggacctgagtgacggt
gtccccatcaagtctcgaaagacagctctggagcatgtaccctcagtggccctcaaggtg
gaaccagctggggaggacctgggcaccactccacccacctctgacttcccacccgaagag
ttcaccttccagcaccttcggaaaggtgccttttgtgagcagtacctgtcagtgccgcag
gccccttaccaatgggcaaagcccaagacgctatctcctacatcatacatgagcccatct
ttacctgccctcgactggcagctgccatctcactctggtccctatgaactgcggattgag
gtacagcccaagtcccatcacagagctcactatgagacagaaggcagccggggggccgtg
aaagcatcagctggaggacaccccattgtgcagctacatggttacttggaaaatgaaccg
ctcacgctacagctgttcattgggacagcagatgaccgcctgctacggccccatgccttc
taccaggtccacaggatcacggggaagaccgtctctaccaccagccatgaggccatcctg
tccaacaccaaagtcctggagatcccactgctcccagaaaataacatgcgagccatcatt
gactgtgctgggatcctgaagctcagaaattcagacatcgagctgcggaaaggggaaaca
gacatcgggaggaagaacaccagagtgcggctggtattccgggtccacatcccacaaccc
aatggccgaacactgtctctccaggttgcctcaaaccctatcgaatgctcccagcggtcg
gcccaggagctgccccttgtggagaagcagagcaccgacagctacccagtcattggtgga
aagaagatggtcctatctggccataactttctgcaagactctaaggtcgttttcgtggag
aaggctccagatggccaccacgtctgggagatggaagcaaaaactgaccgagacctgtgc
aagccaaattccctggtggttgaaataccacctttccgaaaccagagaataaccagccct
gtccaagtcagtttctatgtctgcaacgggaagcggaagagaagccagtaccagcatttc
acctaccttcctgccaatgttccaattataaagacagaacccacggatgactttgagcca
gccctgacctgtggaccaatgagccagggacttagttctttcccgaggccctactatagc
caacagctcactatgcctccggaccccagctcctgcctcgtggctggcttttctccatgc
tcacagaggagtacactgatgtccacatctcccaacacgagtccaaagctccaggacctc
tcctctgctgcctacaccaagggcctcaccagcccaggccatagtggtcaccttggactt
cagccaccggctgcggaggcccccgccatgcaggaagtgccgagacccatggccatgcag
cccagctcaccggagcagcccccgccagccctgctgcagccgcaggtgagtccacatctg
agcagtagctgttcccttggttgccaacaagcgctctgtcccaacagcccctcttctcca
cttccatccgctgcccacgaaccaacctgcttgcagtcctcagcccactctcccaccatg
ggccaccagcagcaccaactgcagaaggttcaaagaaatgagtctccagccgccgggcca
ctgtcactgccagaggtgcgtgagaacagtgatcataatttggcccctattcctgtagcg
atcaagcgagagcctgaagagttggaccagttatacctggacgatgtaaatgaaatcata
cgcaatgacctctccagcgcaaacccccactcctaa

DBGET integrated database retrieval system