KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103735002
Entry
103735002         CDS       T03372                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103735002
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 103735002
NCBI-ProteinID: XP_008832328
LinkDB
Position
Un
AA seq 119 aa
MPKNRTPTQDIRRLAQFMCPEVSSEEERSCINQCSTSAECGLDTVCCPSICGGSCKTPIR
IGIPKAGQCPWNPLHMIPAKPCPEQSECSSDSDCEGIMKCCNIKCAMKCLIPEAEESFY
NT seq 360 nt   +upstreamnt  +downstreamnt
atgcctaagaacagaactccgacccaggatatccgcaggctcgctcagttcatgtgccct
gaggtcagctctgaggaagaaagatcctgtatcaaccagtgcagtaccagtgcagaatgt
ggactggataccgtgtgctgccccagcatatgtggtggttcctgcaaaaccccaatcaga
attggtatcccaaaggctggccaatgcccctggaatccactccacatgatccctgccaag
ccatgcccagagcagagtgaatgctccagtgacagtgactgtgagggcataatgaaatgt
tgtaacatcaaatgtgccatgaagtgtctgatccctgaagcagaggagtccttttattga

DBGET integrated database retrieval system